BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P09 (860 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 0.10 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 27 0.14 08_02_0796 - 21300251-21300373,21300846-21301721 33 0.29 01_01_0659 - 5021159-5021266,5021364-5021494,5021619-5021785,502... 33 0.29 04_03_0670 - 18544745-18545119,18545319-18545551,18546377-185464... 27 0.71 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 27 0.83 02_05_0686 - 30900748-30902167,30903442-30904742 26 0.86 01_05_0490 + 22672241-22674679 29 0.87 03_02_0865 - 11895257-11895340,11896004-11896069,11896297-118963... 29 0.91 04_04_0057 + 22410167-22411330 26 0.92 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 26 0.92 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 27 1.1 11_01_0133 + 1121392-1122731,1123417-1123858 26 1.2 08_01_0060 - 413088-413999 31 1.2 10_07_0020 - 11944054-11944653,11944734-11944847,11944917-119449... 26 1.2 02_01_0363 - 2612873-2613814 26 1.2 02_01_0358 - 2575858-2576796 26 1.2 06_01_0760 - 5676973-5677830 25 1.2 06_01_0690 + 5033943-5034740 25 1.2 10_08_0217 - 15962192-15962884 25 1.2 04_04_1126 + 31095651-31096115 26 1.3 10_08_1026 + 22400551-22401161,22401437-22401632,22401837-224018... 26 1.5 07_01_0015 + 108338-109186 31 1.6 04_04_1687 - 35365766-35366356,35367137-35368135 31 1.6 06_03_1191 + 28286685-28287008,28287149-28287211,28287377-282874... 26 1.6 03_06_0755 - 36029836-36030123,36030352-36030444,36030601-360306... 26 1.6 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 29 1.9 08_01_0204 + 1642169-1642687 30 2.1 02_05_0742 + 31415862-31417088 25 2.6 05_06_0227 + 26565169-26566380 25 2.6 08_02_1143 + 24659105-24659386,24660171-24660272,24661259-246615... 30 2.7 07_03_0154 + 14509979-14512033 30 2.7 06_01_0561 - 3983308-3983564,3983652-3983775 30 2.7 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 30 2.7 01_01_0046 - 331758-332627 30 2.7 03_01_0502 - 3779551-3779562,3779863-3780012,3780129-3780172,378... 25 3.3 01_05_0695 + 24360307-24361050,24362913-24363094,24363177-243633... 26 3.3 07_03_1136 + 24218601-24218734,24218769-24219906 25 3.4 06_03_0696 + 23617687-23617851,23618838-23619536 29 3.6 04_04_0347 + 24564589-24565296 29 3.6 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 3.6 10_02_0111 + 5381779-5382117,5382775-5382798 25 3.8 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 24 4.0 07_03_1382 - 26170563-26170631,26171151-26171843 24 4.6 01_03_0005 + 11568545-11569119,11569179-11569191 24 4.7 05_01_0131 + 888247-888771,889092-889154 24 4.7 12_02_1174 - 26696869-26698191 29 4.8 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 29 4.8 12_02_1070 - 25814741-25815850 29 4.8 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 29 4.8 12_02_0859 - 23751198-23753258 29 4.8 12_02_0408 + 18659494-18660362,18660472-18660634,18660976-186611... 29 4.8 12_02_0299 - 17051570-17052474,17053542-17053755 29 4.8 12_01_0495 - 3935395-3937110 29 4.8 12_01_0373 + 2897874-2898911 29 4.8 12_01_0319 + 2440129-2440661,2440875-2440902 29 4.8 11_06_0645 - 25814302-25814759,25814853-25815005,25815032-258152... 29 4.8 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 29 4.8 11_06_0016 - 19284810-19284926,19285527-19286879 29 4.8 11_05_0093 + 18992027-18993514 29 4.8 10_08_0738 - 20212220-20212282,20212387-20212593,20212690-202128... 29 4.8 10_08_0534 + 18595520-18595828,18595917-18597149 29 4.8 10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 29 4.8 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 29 4.8 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 29 4.8 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 29 4.8 10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 29 4.8 10_02_0009 + 4128909-4130123 29 4.8 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 29 4.8 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 29 4.8 09_03_0145 - 12749288-12751510 29 4.8 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 29 4.8 09_02_0327 - 7284829-7284889,7284946-7286126 29 4.8 09_01_0016 - 376742-376883,377973-378964 29 4.8 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 29 4.8 08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287,164... 29 4.8 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 29 4.8 07_03_1771 - 29404972-29405175,29405282-29405677 29 4.8 07_03_1691 - 28726307-28726323,28726588-28726953,28727483-287275... 29 4.8 07_03_1481 + 26860051-26860104,26861114-26861143,26861714-26863174 29 4.8 07_03_1381 - 26166673-26166747,26166972-26167544 29 4.8 07_03_0890 - 22332768-22333382 29 4.8 07_03_0435 + 18182657-18183509,18184477-18184574,18184663-181848... 29 4.8 07_01_1207 + 11511754-11513865 29 4.8 07_01_1123 - 10385215-10385574,10385676-10385810,10386385-103870... 29 4.8 07_01_0862 - 7172083-7172931 29 4.8 07_01_0753 - 5799733-5799741,5799938-5800642 29 4.8 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 4.8 07_01_0516 - 3850252-3852870 29 4.8 07_01_0080 + 587674-588510 29 4.8 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 29 4.8 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 29 4.8 06_03_0743 + 24069752-24070483,24071890-24072345 29 4.8 06_03_0526 + 21771519-21771607,21771685-21771810,21771890-217720... 29 4.8 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 29 4.8 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 29 4.8 06_01_0835 - 6315762-6316844 29 4.8 06_01_0606 - 4382133-4382704,4383017-4383336,4384152-4384258,438... 29 4.8 05_07_0089 - 27619053-27620138 29 4.8 05_07_0031 - 27183252-27183317,27183542-27184282 29 4.8 05_04_0347 + 20479682-20479753,20480136-20480813,20481143-204821... 29 4.8 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 4.8 05_03_0001 - 7269231-7269436,7269536-7270100,7270600-7270821,727... 29 4.8 05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 29 4.8 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 29 4.8 05_01_0380 + 2978256-2979284 29 4.8 05_01_0210 + 1583176-1584177 29 4.8 05_01_0192 + 1394342-1396645 29 4.8 05_01_0080 - 535443-535481,535569-535698,536483-536586,536686-53... 29 4.8 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 4.8 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 4.8 04_04_0887 + 29095087-29096166 29 4.8 04_04_0708 - 27441373-27442611 29 4.8 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 4.8 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 4.8 04_03_1022 - 21778315-21779007 29 4.8 04_03_0977 + 21381857-21383757,21384299-21384458,21384669-213847... 29 4.8 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 29 4.8 04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 29 4.8 04_01_0354 - 4646826-4647314 29 4.8 04_01_0197 + 2323790-2324098,2324145-2324774 29 4.8 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 29 4.8 03_06_0599 + 34984869-34985319,34986581-34987563 29 4.8 03_06_0411 + 33741903-33742163,33742990-33743168,33743342-337434... 29 4.8 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 29 4.8 03_05_0865 - 28365430-28367640 29 4.8 03_04_0042 - 16743440-16743454,16743907-16744002,16744257-167444... 29 4.8 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 4.8 03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539,117... 29 4.8 02_05_0925 - 32768815-32769654 29 4.8 02_05_0543 + 29872168-29872767,29873089-29873115 29 4.8 02_05_0002 - 24849189-24849825,24850267-24850328 29 4.8 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 4.8 02_03_0279 + 17250347-17252098 29 4.8 02_02_0489 + 10869482-10871218 29 4.8 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 29 4.8 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 4.8 02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570,273... 29 4.8 02_01_0224 - 1461924-1462227,1462602-1462798,1463059-1463213,146... 29 4.8 02_01_0143 + 1030081-1030587,1032106-1032114 29 4.8 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 29 4.8 01_06_1805 - 39999987-40000169,40000648-40000974,40001724-400020... 29 4.8 01_06_1321 + 36280691-36281269 29 4.8 01_06_0969 - 33472588-33474480,33475543-33475623,33475692-334757... 29 4.8 01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 29 4.8 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 29 4.8 01_06_0317 + 28425408-28426079,28426286-28426351 29 4.8 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 4.8 01_05_0423 + 22032940-22033695 29 4.8 01_05_0329 - 21037980-21038378,21038517-21038737,21038827-210389... 29 4.8 01_05_0307 - 20701860-20702168,20702291-20703083,20703183-207032... 29 4.8 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 4.8 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 4.8 01_01_0796 + 6190931-6192745 29 4.8 01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902,467... 29 4.8 03_05_0001 - 19386264-19386284,19386446-19386517,19386614-193873... 24 4.9 10_08_0521 + 18500105-18500529,18501216-18501284,18501467-185015... 24 5.1 02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 24 5.3 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 24 5.7 03_03_0038 + 13984525-13984917,13985351-13985429,13985535-139856... 27 6.0 10_08_0222 - 15983756-15984313 24 6.1 11_06_0202 - 21184217-21184503,21184622-21184982 29 6.3 11_01_0353 - 2648496-2649224 29 6.3 02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425,265... 29 6.3 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 24 6.5 09_04_0759 - 19978748-19979080 24 6.6 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 23 6.7 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 25 6.9 11_06_0047 + 19595904-19596185,19596284-19596424,19597195-195973... 24 7.1 02_05_1164 + 34628391-34628663,34628763-34628816,34628906-346291... 25 7.4 10_08_0922 - 21593030-21593225,21593319-21594142 23 7.4 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 23 7.5 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 25 7.6 06_01_0494 + 3539804-3539949,3540466-3540826 23 8.0 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 28 8.3 02_02_0087 - 6650570-6652021 28 8.3 07_01_0466 - 3518315-3521428 23 8.7 07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398,553... 23 8.9 05_07_0035 - 27221338-27221433,27221510-27221599,27222056-272221... 23 8.9 03_01_0648 - 4749150-4749275,4749902-4749986,4750761-4750861,475... 24 9.0 01_06_1790 - 39888313-39888350,39888437-39888530,39888612-398888... 23 9.1 12_01_0410 - 3234836-3234958,3235636-3235776,3235899-3235949,323... 23 9.2 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 23 9.2 01_01_0347 + 2765517-2767109,2767214-2767228 23 9.3 09_04_0130 - 14905044-14905505,14905865-14905933,14906000-149061... 23 9.3 01_01_0570 - 4231100-4232560 23 9.3 11_06_0326 - 22382001-22383248 23 9.5 10_08_0930 - 21641818-21642240,21642731-21642820,21642902-216429... 24 9.6 06_03_0775 - 24510624-24510655,24511228-24512179 23 9.7 03_02_0553 - 9420960-9421164,9421634-9421812,9421902-9421970,942... 23 9.9 12_01_0841 - 7873458-7874225 23 9.9 04_03_0960 - 21257219-21257953 23 10.0 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 PL P PPPPPPPP Sbjct: 593 PLPNCLVPSPPPPPPPP 609 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P T P PPPPPPPP Sbjct: 537 PSPTAAAPPPPPPPPPP 553 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 545 PPPPPPPPPP 554 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 563 PPPPPPPPPP 572 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 564 PPPPPPPPPP 573 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 565 PPPPPPPPPP 574 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 634 PPPPPPPPPP 643 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 663 PAPPPPPPPP 672 Score = 26.6 bits (56), Expect(2) = 0.10 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P + P PPPPPPP Sbjct: 559 PAFSPPPPPPPPPPPP 574 Score = 26.6 bits (56), Expect(2) = 0.10 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 603 PPPPPPPP 610 Score = 26.2 bits (55), Expect(2) = 1.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 712 PPPPPPPPP 720 Score = 23.4 bits (48), Expect(2) = 1.1 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PP PPPPP Sbjct: 747 PPAPPPPP 754 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 26.6 bits (56), Expect(2) = 0.68 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 106 PPPPPPPP 113 Score = 26.6 bits (56), Expect(2) = 5.4 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 107 PPPPPPPP 114 Score = 26.6 bits (56), Expect(2) = 0.14 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 121 PPPPPPPP 128 Score = 26.2 bits (55), Expect(2) = 0.14 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 106 PPPPPPPPP 114 Score = 23.8 bits (49), Expect(2) = 0.68 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P + P PP PPPP Sbjct: 50 PFLAPPPPPPPGPPPP 65 Score = 20.6 bits (41), Expect(2) = 5.4 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 829 PXPPPPP 849 P PPPPP Sbjct: 92 PPPPPPP 98 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = +1 Query: 802 SXPLIT*XXPXPPPPPPPP 858 S PL+ P PPPPPPPP Sbjct: 96 SPPLLALPPPPPPPPPPPP 114 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 106 PPPPPPPPPP 115 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 107 PPPPPPPPPP 116 >01_01_0659 - 5021159-5021266,5021364-5021494,5021619-5021785, 5021950-5022065,5022226-5022381,5022570-5022678, 5023153-5023262,5023807-5023992,5024077-5024667 Length = 557 Score = 33.1 bits (72), Expect = 0.29 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 284 KFPSIINEGRVEGDKYQISIHLPGYEQKDINVK 382 K ++ E +VEGD Y + +H PG+ K ++V+ Sbjct: 216 KDDEVVKEEKVEGDGYSLGLHAPGFFDKVLHVE 248 >04_03_0670 - 18544745-18545119,18545319-18545551,18546377-18546476, 18546842-18546910,18547822-18547900,18547989-18548224 Length = 363 Score = 27.5 bits (58), Expect(2) = 0.71 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 802 SXPLIT*XXPXPPPPPPP 855 S LI P PPPPPPP Sbjct: 3 SLRLIAAFAPAPPPPPPP 20 Score = 23.0 bits (47), Expect(2) = 0.71 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 15 PPPPPPRP 22 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 26.6 bits (56), Expect(2) = 0.83 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 1180 PPPPPPPP 1187 Score = 23.4 bits (48), Expect(2) = 0.83 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 PL P PPPPPP Sbjct: 1159 PLPPSPPPATPPPPPP 1174 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 26.2 bits (55), Expect(2) = 0.86 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 311 PAPPPPPPP 319 Score = 26.2 bits (55), Expect(2) = 5.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 362 PSPPPPPPP 370 Score = 23.8 bits (49), Expect(2) = 6.8 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 326 PPPPPPP 332 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 835 PPPPPPP 855 PPPPPPP Sbjct: 353 PPPPPPP 359 Score = 23.8 bits (49), Expect(2) = 0.86 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 353 PPPPPPP 359 Score = 23.8 bits (49), Expect(2) = 4.1 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 364 PPPPPPP 370 Score = 23.0 bits (47), Expect(2) = 6.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPP P Sbjct: 313 PPPPPPPKP 321 Score = 21.0 bits (42), Expect(2) = 5.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 841 PPPPPP 858 PPPPPP Sbjct: 377 PPPPPP 382 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 PL P PPPPPPPP Sbjct: 688 PLPPPSPPLPPPPPPPP 704 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 697 PPPPPPPPPP 706 Score = 26.2 bits (55), Expect(2) = 0.87 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 639 PQPPPPPPP 647 Score = 23.8 bits (49), Expect(2) = 0.87 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 664 PPPPPPP 670 >03_02_0865 - 11895257-11895340,11896004-11896069,11896297-11896355, 11896470-11896557,11897158-11897328,11897406-11897564, 11897653-11897835,11897931-11898012,11898753-11898959, 11899099-11899170,11901948-11902055,11902460-11902506 Length = 441 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 200 PAPPPPPPPP 209 Score = 25.8 bits (54), Expect(2) = 0.91 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPP P Sbjct: 202 PPPPPPPPQP 211 Score = 24.2 bits (50), Expect(2) = 0.91 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 PL + PPPPPPP Sbjct: 194 PLPSQVPAPPPPPPPP 209 >04_04_0057 + 22410167-22411330 Length = 387 Score = 26.2 bits (55), Expect(2) = 0.92 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 181 PPPPPPPPP 189 Score = 26.2 bits (55), Expect(2) = 2.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 206 PSPPPPPPP 214 Score = 23.8 bits (49), Expect(2) = 0.92 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 208 PPPPPPP 214 Score = 22.2 bits (45), Expect(2) = 2.6 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +1 Query: 787 ITCXXSXPLIT*XXPXPPPPP 849 +TC + P PPPPP Sbjct: 169 VTCPLCRANLEKPPPPPPPPP 189 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 26.2 bits (55), Expect(2) = 0.92 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 54 PPPPPPPPP 62 Score = 23.8 bits (49), Expect(2) = 0.92 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 81 PPPPPPP 87 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 26.6 bits (56), Expect(2) = 1.1 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 290 PPPPPPPP 297 Score = 23.0 bits (47), Expect(2) = 1.1 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P ++ P PPPPP P Sbjct: 264 PELSKLPPIPPPPPMP 279 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 132 PAPPPPPPP 140 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 164 PPPPPPQP 171 >08_01_0060 - 413088-413999 Length = 303 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 PL+ P PPPPPPPP Sbjct: 23 PLLFDQPPPPPPPPPPP 39 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 31 PPPPPPPPPP 40 >10_07_0020 - 11944054-11944653,11944734-11944847,11944917-11944976, 11945154-11945474,11945556-11945594 Length = 377 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 137 PAPPPPPPP 145 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 140 PPPPPPSP 147 >02_01_0363 - 2612873-2613814 Length = 313 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 109 PLPPPPPPP 117 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 112 PPPPPPSP 119 >02_01_0358 - 2575858-2576796 Length = 312 Score = 26.2 bits (55), Expect(2) = 1.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 109 PLPPPPPPP 117 Score = 23.4 bits (48), Expect(2) = 1.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 112 PPPPPPSP 119 >06_01_0760 - 5676973-5677830 Length = 285 Score = 25.4 bits (53), Expect(2) = 1.2 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 36 GGGGGGGGSG 45 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 71 GGGGGGGGGGGQ 82 >06_01_0690 + 5033943-5034740 Length = 265 Score = 25.4 bits (53), Expect(2) = 1.2 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 69 GGGGGGGGGG 78 Score = 25.4 bits (53), Expect(2) = 1.2 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 110 GGGGGGGGGG 119 Score = 25.4 bits (53), Expect(2) = 1.2 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 153 GGGGGGGGGG 162 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 110 GGGGGGGGGGGQ 121 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 152 GGGGGGGGGGGQ 163 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 191 GGGGGGGGGGGQ 202 >10_08_0217 - 15962192-15962884 Length = 230 Score = 25.4 bits (53), Expect(2) = 1.2 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 33 GGGGGGGGGG 42 Score = 24.2 bits (50), Expect(2) = 1.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 71 GGGGGGGGGGGQ 82 >04_04_1126 + 31095651-31096115 Length = 154 Score = 26.2 bits (55), Expect(2) = 1.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 39 PKPPPPPPP 47 Score = 23.4 bits (48), Expect(2) = 1.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 42 PPPPPPAP 49 >10_08_1026 + 22400551-22401161,22401437-22401632,22401837-22401889, 22402369-22402819 Length = 436 Score = 26.2 bits (55), Expect(2) = 1.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 127 PAPPPPPPP 135 Score = 23.0 bits (47), Expect(2) = 1.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 130 PPPPPPVP 137 >07_01_0015 + 108338-109186 Length = 282 Score = 30.7 bits (66), Expect = 1.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P ++ P PPPPPPPP Sbjct: 98 PTVSICAPPPPPPPPPP 114 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P T P PPPPPPPP Sbjct: 5 PAATAPPPPPPPPPPPP 21 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 13 PPPPPPPPPP 22 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 14 PPPPPPPPPP 23 >06_03_1191 + 28286685-28287008,28287149-28287211,28287377-28287461, 28287561-28287623,28287954-28288029,28288190-28288223, 28289553-28289659,28289738-28289807,28289852-28289950 Length = 306 Score = 26.2 bits (55), Expect(2) = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 19 PPPPPPPPP 27 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PP PPPPP Sbjct: 41 PPHPPPPP 48 >03_06_0755 - 36029836-36030123,36030352-36030444,36030601-36030676, 36030755-36030880,36030957-36031013,36031132-36031253 Length = 253 Score = 26.2 bits (55), Expect(2) = 1.6 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPPP Sbjct: 20 PSPPPPPPP 28 Score = 23.0 bits (47), Expect(2) = 1.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 23 PPPPPPRP 30 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 29.5 bits (63), Expect = 3.6 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P ++ P PPPPPPPP Sbjct: 299 PELSKLPPIPPPPPPPP 315 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 308 PPPPPPPPPP 317 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 309 PPPPPPPPPP 318 Score = 25.8 bits (54), Expect(2) = 1.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPP Sbjct: 339 PPAPPPPPPP 348 Score = 23.0 bits (47), Expect(2) = 1.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P I P PPPPP P Sbjct: 305 PPIPPPPPPPPPPPMP 320 >08_01_0204 + 1642169-1642687 Length = 172 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = +1 Query: 784 CITCXXSXPLI--T*XXPXPPPPPPPP 858 CI P + T P PPPPPPPP Sbjct: 138 CIVTIFGEPRVSKTNKMPQPPPPPPPP 164 >02_05_0742 + 31415862-31417088 Length = 408 Score = 25.4 bits (53), Expect(2) = 2.6 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 342 GGGGGGGGGG 351 Score = 23.0 bits (47), Expect(2) = 2.6 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = -1 Query: 851 GGGGGGXGXXQVMXG 807 GGGGGG G Q G Sbjct: 377 GGGGGGGGSSQQQHG 391 >05_06_0227 + 26565169-26566380 Length = 403 Score = 25.0 bits (52), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPP P Sbjct: 45 PAPPPPPPLP 54 Score = 23.4 bits (48), Expect(2) = 2.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +1 Query: 814 IT*XXPXPPPPPPP 855 +T P PPPPPP Sbjct: 39 LTKAEPPAPPPPPP 52 >08_02_1143 + 24659105-24659386,24660171-24660272,24661259-24661521, 24661775-24661874,24662080-24662238,24662327-24663147, 24663299-24663618,24665831-24667398 Length = 1204 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 802 SXPLIT*XXPXPPPPPPPP 858 S P + P PPPPPPPP Sbjct: 711 SPPHLRIPRPWPPPPPPPP 729 >07_03_0154 + 14509979-14512033 Length = 684 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 PL P PPPPPPPP Sbjct: 47 PLPAAAPPPPPPPPPPP 63 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 55 PPPPPPPPPP 64 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 56 PPPPPPPPPP 65 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 57 PPPPPPPPPP 66 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +1 Query: 802 SXPLIT*XXPXPPPPPPPP 858 S P + P PPPPPPPP Sbjct: 22 SSPTSSSSSPPPPPPPPPP 40 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P T P PPPPPPPP Sbjct: 416 PTHTHGPPPPPPPPPPP 432 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 424 PPPPPPPPPP 433 >01_01_0046 - 331758-332627 Length = 289 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P T P PPPPPPPP Sbjct: 16 PYWTSPPPPPPPPPPPP 32 >03_01_0502 - 3779551-3779562,3779863-3780012,3780129-3780172, 3780256-3780319,3780422-3780655,3780765-3780908, 3781027-3781221,3781447-3781522,3781689-3781788, 3781955-3781988,3782076-3782160,3782226-3782290, 3782380-3782478,3782810-3782875,3785485-3785721 Length = 534 Score = 25.0 bits (52), Expect(2) = 3.3 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 854 GGGGGGGXGXXQVMXG 807 GGGGGGG G ++ G Sbjct: 8 GGGGGGGGGGLELSVG 23 Score = 23.0 bits (47), Expect(2) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 6 GAGGGGGGGG 15 >01_05_0695 + 24360307-24361050,24362913-24363094,24363177-24363332, 24363413-24363749 Length = 472 Score = 26.2 bits (55), Expect(2) = 3.3 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = -1 Query: 854 GGGGGGGXGXXQVMXGXEXXHVIH*XLTCIGDQIN 750 GGGGGGG G + + + +GD +N Sbjct: 178 GGGGGGGGGSREAALALALEQCRNRRVVFVGDSLN 212 Score = 21.8 bits (44), Expect(2) = 3.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 176 GCGGGGGGGG 185 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 25.4 bits (53), Expect(2) = 7.3 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 174 GGGGGGGGPG 183 Score = 25.4 bits (53), Expect(2) = 3.4 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGGG G Sbjct: 187 GGGGGGGGPG 196 Score = 24.2 bits (50), Expect(2) = 4.3 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 854 GGGGGGGXGXXQV 816 GGGGGGG G +V Sbjct: 352 GGGGGGGGGGTKV 364 Score = 23.4 bits (48), Expect(2) = 9.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 277 GGGGGGGG 284 Score = 23.4 bits (48), Expect(2) = 4.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 319 GGGGGGGG 326 Score = 23.4 bits (48), Expect(2) = 9.5 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 374 GGGGGGGG 381 Score = 23.0 bits (47), Expect(2) = 9.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 318 GGGGGGGGG 326 Score = 23.0 bits (47), Expect(2) = 9.5 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 398 GGGGGGGGG 406 Score = 22.6 bits (46), Expect(2) = 3.4 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 854 GGGGGGGXGXXQVMXG 807 GGGGGGG V+ G Sbjct: 223 GGGGGGGGALKCVVGG 238 Score = 21.4 bits (43), Expect(2) = 7.3 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = -1 Query: 851 GGGGGGXGXXQVMXG 807 GGGGGG G + G Sbjct: 187 GGGGGGGGPGRAPGG 201 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 811 LIT*XXPXPPPPPPPP 858 LI P PPPPPPPP Sbjct: 72 LIKQTPPPPPPPPPPP 87 >04_04_0347 + 24564589-24565296 Length = 235 Score = 29.5 bits (63), Expect = 3.6 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 79 MIALVLCGLLAAVSAAPQYYHGSSHWPY-HHYDPF 180 M L+ LLAA SAA +H ++ PY HH+ P+ Sbjct: 5 MSMLLASSLLAAASAARADHHSPAYAPYPHHHAPW 39 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +1 Query: 787 ITCXXSXPLIT*XXPXPPPPPPPP 858 +T P+ P PPPPPPPP Sbjct: 335 VTSPSPRPVQPSNAPPPPPPPPPP 358 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 350 PPPPPPPPPP 359 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 351 PPPPPPPPPP 360 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 352 PPPPPPPPPP 361 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 353 PPPPPPPPPP 362 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 354 PPPPPPPPPP 363 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 355 PPPPPPPPPP 364 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 356 PPPPPPPPPP 365 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 371 PKPPPPPPPP 380 >10_02_0111 + 5381779-5382117,5382775-5382798 Length = 120 Score = 25.0 bits (52), Expect(2) = 3.8 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 854 GGGGGGGXGXXQVMXG 807 GGGGGGG G ++ G Sbjct: 16 GGGGGGGGGGARLQGG 31 Score = 23.0 bits (47), Expect(2) = 3.8 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 GG GGGGG G Sbjct: 13 GGAGGGGGGG 22 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 24.2 bits (50), Expect(2) = 4.0 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P++ P PPPPPP Sbjct: 41 PVVGSPPPPSPPPPPP 56 Score = 23.4 bits (48), Expect(2) = 4.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 P PPPPPP Sbjct: 72 PSPPPPPP 79 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 835 PPPPPPP 855 PPPPPPP Sbjct: 184 PPPPPPP 190 Score = 23.8 bits (49), Expect(2) = 4.6 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 200 PPPPPPP 206 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 24.2 bits (50), Expect(2) = 4.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 118 GGGGGGGGGWQQ 129 Score = 23.4 bits (48), Expect(2) = 4.7 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 79 GGGGGGGG 86 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 23.8 bits (49), Expect(2) = 4.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 835 PPPPPPP 855 PPPPPPP Sbjct: 133 PPPPPPP 139 Score = 23.8 bits (49), Expect(2) = 4.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 160 PPPPPPP 166 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 153 PPPPPPPPPP 162 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 154 PPPPPPPPPP 163 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 155 PPPPPPPPPP 164 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 156 PPPPPPPPPP 165 Score = 25.8 bits (54), Expect(2) = 7.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PP PPPPP Sbjct: 296 PPPPSPPPPP 305 Score = 24.6 bits (51), Expect(2) = 5.6 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +1 Query: 808 PLIT*XXPXPPPPPP 852 P + P PPPPPP Sbjct: 237 PAVVEPKPQPPPPPP 251 Score = 22.6 bits (46), Expect(2) = 5.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 829 PXPPPPPPPP 858 P P PPPP P Sbjct: 263 PKPSPPPPSP 272 Score = 21.0 bits (42), Expect(2) = 7.3 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +1 Query: 802 SXPLIT*XXPXPPPPPPP 855 S +T P P PPPP Sbjct: 282 SPTAVTPPEPTKPKPPPP 299 >12_02_1119 + 26213719-26213955,26214039-26214197,26214640-26214702, 26214813-26214902,26214984-26215106,26215344-26215431, 26217043-26217117,26218109-26218215 Length = 313 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 14 PPPPPPPPPP 23 >12_02_1070 - 25814741-25815850 Length = 369 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 237 PPPPPPPPPP 246 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 238 PPPPPPPPPP 247 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 239 PPPPPPPPPP 248 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 39 PPPPPPPPPP 48 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 40 PPPPPPPPPP 49 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 41 PPPPPPPPPP 50 >12_02_0859 - 23751198-23753258 Length = 686 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 624 PEPPPPPPPP 633 >12_02_0408 + 18659494-18660362,18660472-18660634,18660976-18661139, 18661253-18661511,18661605-18661712 Length = 520 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 145 PPPPPPPPPP 154 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 318 PSPPPPPPPP 327 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 320 PPPPPPPPPP 329 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 321 PPPPPPPPPP 330 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 322 PPPPPPPPPP 331 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 323 PPPPPPPPPP 332 >12_01_0495 - 3935395-3937110 Length = 571 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 8 PLPPPPPPPP 17 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 10 PPPPPPPPPP 19 >12_01_0373 + 2897874-2898911 Length = 345 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 155 PPPPPPPPPP 164 >12_01_0319 + 2440129-2440661,2440875-2440902 Length = 186 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 46 PPPPPPPPPP 55 >11_06_0645 - 25814302-25814759,25814853-25815005,25815032-25815214, 25815342-25815531,25815624-25815784,25816136-25816623, 25817035-25817075 Length = 557 Score = 29.1 bits (62), Expect = 4.8 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +2 Query: 296 IINEGRVEGDKYQISIHLPGYEQKDINVKAKNGVLMVQANSAFNHYLKIXNLP 454 I ++G++EG + I H+P E D+ V + + + +S H K N P Sbjct: 351 ISSKGQLEGIQVVIDPHVPSVESVDMPVSSMDNSTLEVFSSQQQHSFKCNNTP 403 >11_06_0208 - 21268722-21268763,21269146-21269274,21269388-21269537, 21270402-21270773 Length = 230 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 16 PGPPPPPPPP 25 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 18 PPPPPPPPPP 27 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 85 PSPPPPPPPP 94 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 87 PPPPPPPPPP 96 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 88 PPPPPPPPPP 97 >11_05_0093 + 18992027-18993514 Length = 495 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 372 PNPPPPPPPP 381 >10_08_0738 - 20212220-20212282,20212387-20212593,20212690-20212819, 20212919-20213089,20213311-20213433,20213517-20213618, 20214123-20214880 Length = 517 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 24 PHPPPPPPPP 33 >10_08_0534 + 18595520-18595828,18595917-18597149 Length = 513 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 33 PSPPPPPPPP 42 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 35 PPPPPPPPPP 44 >10_08_0527 - 18555231-18555882,18556334-18556463,18557073-18557175 Length = 294 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 201 PPPPPPPPPP 210 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 202 PPPPPPPPPP 211 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPPP 858 P+ T PPPPPPPP Sbjct: 192 PISTCILALPPPPPPPP 208 >10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 Length = 474 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 320 PPPPPPPPPP 329 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 329 PAPPPPPPPP 338 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 346 PKPPPPPPPP 355 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 338 PPPPPPPPPP 347 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 339 PPPPPPPPPP 348 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 340 PPPPPPPPPP 349 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 341 PPPPPPPPPP 350 >10_02_0134 + 5667236-5669295,5669833-5669902,5670266-5670376 Length = 746 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 6 PPPPPPPPPP 15 >10_02_0009 + 4128909-4130123 Length = 404 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 82 PSPPPPPPPP 91 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 84 PPPPPPPPPP 93 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 80 PSPPPPPPPP 89 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 82 PPPPPPPPPP 91 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 83 PPPPPPPPPP 92 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 84 PPPPPPPPPP 93 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 85 PPPPPPPPPP 94 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 86 PPPPPPPPPP 95 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 264 PPPPPPPPPP 273 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 265 PPPPPPPPPP 274 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 266 PPPPPPPPPP 275 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 267 PPPPPPPPPP 276 >09_03_0145 - 12749288-12751510 Length = 740 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 28 PSPPPPPPPP 37 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 12 PAPPPPPPPP 21 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 14 PPPPPPPPPP 23 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 15 PPPPPPPPPP 24 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 16 PPPPPPPPPP 25 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 17 PPPPPPPPPP 26 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 18 PPPPPPPPPP 27 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 53 PPPPPPPPPP 62 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 54 PPPPPPPPPP 63 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 55 PPPPPPPPPP 64 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 56 PPPPPPPPPP 65 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 57 PPPPPPPPPP 66 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 58 PPPPPPPPPP 67 >09_01_0016 - 376742-376883,377973-378964 Length = 377 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 60 PPPPPPPPPP 69 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 61 PPPPPPPPPP 70 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 429 PLPPPPPPPP 438 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 431 PPPPPPPPPP 440 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 432 PPPPPPPPPP 441 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 433 PPPPPPPPPP 442 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 434 PPPPPPPPPP 443 >08_01_0207 - 1647168-1647251,1647583-1647726,1648176-1648287, 1648392-1648573,1648649-1648780,1648900-1649856, 1649949-1650734 Length = 798 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 509 PKPPPPPPPP 518 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 18 PPPPPPPPPP 27 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 19 PPPPPPPPPP 28 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 14 PLPPPPPPPP 23 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 16 PPPPPPPPPP 25 >07_03_1691 - 28726307-28726323,28726588-28726953,28727483-28727567, 28728255-28728387,28729793-28730328 Length = 378 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 42 PTPPPPPPPP 51 >07_03_1481 + 26860051-26860104,26861114-26861143,26861714-26863174 Length = 514 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 69 PQPPPPPPPP 78 >07_03_1381 - 26166673-26166747,26166972-26167544 Length = 215 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 161 PPPPPPPPPP 170 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 84 PPPPPPPPPP 93 >07_03_0435 + 18182657-18183509,18184477-18184574,18184663-18184833, 18185524-18185624,18185702-18185837,18186007-18186057, 18186202-18186489,18186610-18186844,18186924-18187204, 18187336-18187557 Length = 811 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 77 PQPPPPPPPP 86 >07_01_1207 + 11511754-11513865 Length = 703 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 11 PRPPPPPPPP 20 >07_01_1123 - 10385215-10385574,10385676-10385810,10386385-10387091, 10387158-10387455 Length = 499 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 7 PIPPPPPPPP 16 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 125 PAPPPPPPPP 134 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 127 PPPPPPPPPP 136 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 43 PPPPPPPPPP 52 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 44 PPPPPPPPPP 53 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 45 PPPPPPPPPP 54 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 228 PLPPPPPPPP 237 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 249 PLPPPPPPPP 258 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 25 PLPPPPPPPP 34 >07_01_0080 + 587674-588510 Length = 278 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 104 PPPPPPPPPP 113 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 105 PPPPPPPPPP 114 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 106 PPPPPPPPPP 115 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 107 PPPPPPPPPP 116 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 108 PPPPPPPPPP 117 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 109 PPPPPPPPPP 118 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 110 PPPPPPPPPP 119 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 111 PPPPPPPPPP 120 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 112 PPPPPPPPPP 121 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 89 PTPPPPPPPP 98 >06_03_0750 - 24140988-24141037,24141108-24141345,24142158-24142232, 24142345-24142413,24142550-24142581,24143503-24143583, 24143791-24143851,24144135-24144275,24144372-24144563 Length = 312 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 41 PSPPPPPPPP 50 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 25 PPPPPPPPPP 34 >06_03_0526 + 21771519-21771607,21771685-21771810,21771890-21772010, 21772123-21772851,21772954-21773349,21774594-21774665, 21774741-21774803,21775236-21775337 Length = 565 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 310 PPPPPPPPPP 319 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 201 PLPPPPPPPP 210 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 203 PPPPPPPPPP 212 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 53 PHPPPPPPPP 62 >06_01_0835 - 6315762-6316844 Length = 360 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 312 PLPPPPPPPP 321 >06_01_0606 - 4382133-4382704,4383017-4383336,4384152-4384258, 4384339-4384512,4384956-4385204,4386831-4386986 Length = 525 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 40 PAPPPPPPPP 49 >05_07_0089 - 27619053-27620138 Length = 361 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -1 Query: 857 GGGGGGGGXGXXQVMXGXE 801 GGGGGGGG G VM E Sbjct: 141 GGGGGGGGGGGGAVMMSAE 159 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 115 PSPPPPPPPP 124 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 117 PPPPPPPPPP 126 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 118 PPPPPPPPPP 127 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 119 PPPPPPPPPP 128 >05_04_0347 + 20479682-20479753,20480136-20480813,20481143-20482195, 20482345-20482406,20482491-20482541,20482635-20482719, 20483253-20483342,20483472-20483563,20483704-20483728 Length = 735 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 696 PNPPPPPPPP 705 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 216 PQPPPPPPPP 225 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 218 PPPPPPPPPP 227 >05_03_0001 - 7269231-7269436,7269536-7270100,7270600-7270821, 7270913-7271155,7271227-7271481,7272017-7272370, 7273082-7273164,7273250-7273630,7273874-7274027 Length = 820 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 2 PAPPPPPPPP 11 >05_02_0081 + 6432957-6433289,6433367-6433882,6434283-6434570 Length = 378 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 168 PSPPPPPPPP 177 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 579 PPPPPPPPPP 588 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 580 PPPPPPPPPP 589 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 581 PPPPPPPPPP 590 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 26 PPPPPPPPPP 35 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 27 PPPPPPPPPP 36 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 28 PPPPPPPPPP 37 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 29 PPPPPPPPPP 38 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 30 PPPPPPPPPP 39 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 31 PPPPPPPPPP 40 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 32 PPPPPPPPPP 41 >05_01_0210 + 1583176-1584177 Length = 333 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 30 PLPPPPPPPP 39 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 32 PPPPPPPPPP 41 >05_01_0192 + 1394342-1396645 Length = 767 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 3 PPPPPPPPPP 12 >05_01_0080 - 535443-535481,535569-535698,536483-536586,536686-536903, 537755-537762,538146-538183,538475-538668,539168-539296, 539392-539481,539726-539839,540008-540154,540228-540293, 540876-540987 Length = 462 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 324 PSPPPPPPPP 333 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 77 PPPPPPPPPP 86 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 24 PVPPPPPPPP 33 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 26 PPPPPPPPPP 35 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 27 PPPPPPPPPP 36 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 28 PPPPPPPPPP 37 >04_04_0887 + 29095087-29096166 Length = 359 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 132 PPPPPPPPPP 141 >04_04_0708 - 27441373-27442611 Length = 412 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 241 PPPPPPPPPP 250 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 242 PPPPPPPPPP 251 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 549 PPPPPPPPPP 558 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 550 PPPPPPPPPP 559 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 551 PPPPPPPPPP 560 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 365 PPPPPPPPPP 374 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 366 PPPPPPPPPP 375 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 367 PPPPPPPPPP 376 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 368 PPPPPPPPPP 377 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 369 PPPPPPPPPP 378 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 36 PPPPPPPPPP 45 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 37 PPPPPPPPPP 46 >04_03_0977 + 21381857-21383757,21384299-21384458,21384669-21384717, 21385117-21385169 Length = 720 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 101 PPPPPPPPPP 110 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 50 PRPPPPPPPP 59 >04_03_0243 - 13271384-13272865,13272987-13273248,13274617-13276067 Length = 1064 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 160 PPPPPPPPPP 169 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 161 PPPPPPPPPP 170 >04_01_0354 - 4646826-4647314 Length = 162 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 93 PPPPPPPPPP 102 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 94 PPPPPPPPPP 103 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 95 PPPPPPPPPP 104 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 27 PPPPPPPPPP 36 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 28 PPPPPPPPPP 37 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 29 PPPPPPPPPP 38 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 30 PPPPPPPPPP 39 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 31 PPPPPPPPPP 40 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 32 PPPPPPPPPP 41 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 355 PPPPPPPPPP 364 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 356 PPPPPPPPPP 365 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 357 PPPPPPPPPP 366 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 402 PQPPPPPPPP 411 >03_06_0411 + 33741903-33742163,33742990-33743168,33743342-33743426, 33743506-33743822,33743983-33744106,33744810-33744902, 33745296-33745364,33745654-33745704,33745705-33745854, 33745904-33746125,33746413-33746568,33746716-33746823, 33746992-33747126,33747209-33747364,33747544-33747664, 33748182-33748267 Length = 770 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 416 PPPPPPPPPP 425 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 14 PTPPPPPPPP 23 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 16 PPPPPPPPPP 25 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 17 PPPPPPPPPP 26 >03_05_0865 - 28365430-28367640 Length = 736 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 46 PRPPPPPPPP 55 >03_04_0042 - 16743440-16743454,16743907-16744002,16744257-16744475, 16744830-16744910,16745092-16745187,16745981-16746045, 16746131-16746217,16746522-16746720 Length = 285 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 15 PRPPPPPPPP 24 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 428 PPPPPPPPPP 437 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 429 PPPPPPPPPP 438 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 430 PPPPPPPPPP 439 >03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539, 1178179-1178378,1178505-1178605,1178747-1179369, 1179451-1179546,1179637-1179798,1179889-1180068, 1180173-1180323,1180408-1180641,1180753-1180913, 1181041-1181163,1181261-1181421,1181655-1181877, 1181952-1182346,1182461-1182671,1183536-1184522 Length = 1883 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 75 PAPPPPPPPP 84 >02_05_0925 - 32768815-32769654 Length = 279 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 156 PPPPPPPPPP 165 >02_05_0543 + 29872168-29872767,29873089-29873115 Length = 208 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 182 PPPPPPPPPP 191 >02_05_0002 - 24849189-24849825,24850267-24850328 Length = 232 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 216 PHPPPPPPPP 225 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 38 PPPPPPPPPP 47 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 39 PPPPPPPPPP 48 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 40 PPPPPPPPPP 49 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 41 PPPPPPPPPP 50 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 42 PPPPPPPPPP 51 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 43 PPPPPPPPPP 52 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 44 PPPPPPPPPP 53 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 45 PPPPPPPPPP 54 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 46 PPPPPPPPPP 55 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 47 PPPPPPPPPP 56 >02_03_0279 + 17250347-17252098 Length = 583 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 124 PPPPPPPPPP 133 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 125 PPPPPPPPPP 134 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 126 PPPPPPPPPP 135 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 127 PPPPPPPPPP 136 >02_02_0489 + 10869482-10871218 Length = 578 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 8 PTPPPPPPPP 17 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 37 PPPPPPPPPP 46 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 38 PPPPPPPPPP 47 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 353 PPPPPPPPPP 362 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 354 PPPPPPPPPP 363 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 355 PPPPPPPPPP 364 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 356 PPPPPPPPPP 365 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 357 PPPPPPPPPP 366 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 358 PPPPPPPPPP 367 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 359 PPPPPPPPPP 368 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 360 PPPPPPPPPP 369 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 361 PPPPPPPPPP 370 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 362 PPPPPPPPPP 371 >02_01_0377 + 2728892-2729187,2729483-2729544,2730516-2730570, 2730784-2730858,2730980-2731054,2731155-2731202, 2731548-2732357,2732450-2732498,2733157-2733266, 2733381-2733488,2733920-2733980 Length = 582 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 12 PPPPPPPPPP 21 >02_01_0224 - 1461924-1462227,1462602-1462798,1463059-1463213, 1464101-1464207,1464289-1464375,1465332-1465414, 1465959-1466027,1466332-1466658,1466744-1466957, 1467170-1467267,1467516-1467554,1467672-1468160 Length = 722 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 32 PTPPPPPPPP 41 >02_01_0143 + 1030081-1030587,1032106-1032114 Length = 171 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 56 PSPPPPPPPP 65 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 532 PAPPPPPPPP 541 >01_06_1805 - 39999987-40000169,40000648-40000974,40001724-40002017, 40002112-40002231,40002714-40002776,40003150-40003310, 40003864-40004035 Length = 439 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 25 PLPPPPPPPP 34 >01_06_1321 + 36280691-36281269 Length = 192 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 145 PSPPPPPPPP 154 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 147 PPPPPPPPPP 156 >01_06_0969 - 33472588-33474480,33475543-33475623,33475692-33475740, 33475866-33476281,33477208-33477447 Length = 892 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 272 PQPPPPPPPP 281 >01_06_0883 + 32708037-32708558,32708627-32708911,32709661-32709675 Length = 273 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 38 PPPPPPPPPP 47 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 2 PPPPPPPPPP 11 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 3 PPPPPPPPPP 12 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 4 PPPPPPPPPP 13 >01_06_0317 + 28425408-28426079,28426286-28426351 Length = 245 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 125 PLPPPPPPPP 134 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 74 PSPPPPPPPP 83 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 76 PPPPPPPPPP 85 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 77 PPPPPPPPPP 86 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 78 PPPPPPPPPP 87 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 79 PPPPPPPPPP 88 >01_05_0423 + 22032940-22033695 Length = 251 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 26 PQPPPPPPPP 35 >01_05_0329 - 21037980-21038378,21038517-21038737,21038827-21038905, 21039002-21039071,21039144-21039255,21039359-21039398, 21039482-21039676,21039925-21040044,21040684-21041106, 21042386-21042928 Length = 733 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 90 PRPPPPPPPP 99 >01_05_0307 - 20701860-20702168,20702291-20703083,20703183-20703278, 20703391-20703518 Length = 441 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 253 PLPPPPPPPP 262 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 80 PSPPPPPPPP 89 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 126 PPPPPPPPPP 135 >01_01_0796 + 6190931-6192745 Length = 604 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 193 PPPPPPPPPP 202 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 194 PPPPPPPPPP 203 >01_01_0623 + 4672581-4673413,4674274-4674389,4674694-4674902, 4675953-4676072,4676185-4676313,4676394-4676442, 4676899-4676970,4677574-4677707,4677798-4677915, 4678332-4678541,4678630-4678942,4679539-4679632, 4679854-4679962,4680243-4680514,4680597-4680724, 4680832-4681066,4681570-4681758,4681845-4682128, 4682218-4682398,4682486-4682728,4682904-4682986, 4683119-4683227,4687996-4688091,4688675-4688764, 4688881-4689129,4689233-4689412,4690179-4690250, 4691385-4691474,4691605-4691705,4691794-4691959 Length = 1757 Score = 29.1 bits (62), Expect = 4.8 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 829 PXPPPPPPPP 858 P PPPPPPPP Sbjct: 53 PSPPPPPPPP 62 >03_05_0001 - 19386264-19386284,19386446-19386517,19386614-19387357, 19387454-19388884,19388953-19389118,19392035-19392114, 19392393-19392462,19392550-19392761,19392837-19392890, 19393471-19393623,19393715-19393930,19394029-19394248, 19394332-19394399,19394510-19394643,19394755-19394854, 19394943-19395421,19395506-19395699,19396270-19396355, 19396364-19396444,19396842-19397023,19397305-19397346, 19398247-19398558,19399374-19399434,19399435-19399617, 19399744-19399863,19400380-19401051,19402597-19402668, 19402742-19402865,19403563-19403651,19405023-19405097 Length = 2170 Score = 23.8 bits (49), Expect(2) = 4.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P ++ P PPPPPP Sbjct: 2042 PSLSSMQPRAPPPPPP 2057 Score = 23.4 bits (48), Expect(2) = 4.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 2052 PPPPPPQP 2059 >10_08_0521 + 18500105-18500529,18501216-18501284,18501467-18501555, 18501726-18501838,18502023-18502124,18502576-18502663, 18502795-18503361,18503766-18504149,18504168-18504384, 18504466-18504548,18505174-18505256,18505796-18506032, 18506481-18506658,18506814-18507328,18507740-18507916, 18508385-18508768,18508885-18509031 Length = 1285 Score = 24.2 bits (50), Expect(2) = 5.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 99 GGGGGGGGGGQQ 110 Score = 23.0 bits (47), Expect(2) = 5.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 78 GAGGGGGGVG 87 >02_04_0180 + 20696258-20698398,20698691-20698871,20698998-20699060 Length = 794 Score = 23.8 bits (49), Expect(2) = 5.3 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 38 PPPPPPP 44 Score = 23.4 bits (48), Expect(2) = 5.3 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 829 PXPPPPPP 852 P PPPPPP Sbjct: 11 PPPPPPPP 18 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 23.8 bits (49), Expect(2) = 5.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 305 PPPPPPP 311 Score = 23.4 bits (48), Expect(2) = 5.7 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +1 Query: 808 PLIT*XXPXPPPPPPP 855 P + P PPPPPP Sbjct: 270 PQVPPPPPQAPPPPPP 285 >03_03_0038 + 13984525-13984917,13985351-13985429,13985535-13985628, 13985712-13985844 Length = 232 Score = 26.6 bits (56), Expect(2) = 6.0 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPPPP Sbjct: 80 PPPPPPPP 87 Score = 20.6 bits (41), Expect(2) = 6.0 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +1 Query: 829 PXPPPPP 849 P PPPPP Sbjct: 38 PPPPPPP 44 >10_08_0222 - 15983756-15984313 Length = 185 Score = 24.2 bits (50), Expect(2) = 6.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 111 GGGGGGGSGGGQ 122 Score = 23.0 bits (47), Expect(2) = 6.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGGGGG G Sbjct: 70 GGGGGGGSGG 79 >11_06_0202 - 21184217-21184503,21184622-21184982 Length = 215 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +1 Query: 802 SXPLIT*XXPXPPPPPPP 855 S P T P PPPPPPP Sbjct: 169 SPPPFTSPSPLPPPPPPP 186 >11_01_0353 - 2648496-2649224 Length = 242 Score = 28.7 bits (61), Expect = 6.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 854 GGGGGGGXGXXQVMXGXEXXHV 789 GGGGGGG G Q G HV Sbjct: 5 GGGGGGGGGRHQFPVGRRRRHV 26 >02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425, 2657523-2657649,2657731-2657812,2658172-2658196 Length = 2621 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/50 (26%), Positives = 28/50 (56%) Frame = +2 Query: 191 VRESMLDTHSLWSNLANEMQHLDDMMKELSLKFPSIINEGRVEGDKYQIS 340 +++++L+ LA+E+Q D ++ EL K S + R+E + ++S Sbjct: 1298 LKQTLLEKSGELEKLAHELQSKDSLLIELEAKIKSYADADRIEALESELS 1347 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 23.8 bits (49), Expect(2) = 6.5 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +1 Query: 838 PPPPPPP 858 PPPPPPP Sbjct: 1109 PPPPPPP 1115 Score = 23.0 bits (47), Expect(2) = 6.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 829 PXPPPPPPP 855 P PP PPPP Sbjct: 1060 PSPPSPPPP 1068 >09_04_0759 - 19978748-19979080 Length = 110 Score = 24.2 bits (50), Expect(2) = 6.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 5 GGGGGGGGGGGQ 16 Score = 23.0 bits (47), Expect(2) = 6.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 GG GGGGG G Sbjct: 2 GGSGGGGGGG 11 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 23.4 bits (48), Expect(2) = 6.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 829 PXPPPPPP 852 P PPPPPP Sbjct: 964 PPPPPPPP 971 Score = 23.4 bits (48), Expect(2) = 6.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPP PP Sbjct: 984 PPPPPSPP 991 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 25.0 bits (52), Expect(2) = 6.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 854 GGGGGGGXGXXQVM 813 GGGGGGG G ++M Sbjct: 377 GGGGGGGGGSGKMM 390 Score = 21.8 bits (44), Expect(2) = 6.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 375 GVGGGGGGGG 384 >11_06_0047 + 19595904-19596185,19596284-19596424,19597195-19597307, 19597970-19598049,19598557-19598720,19598931-19599060, 19599155-19599254,19599452-19599500,19599775-19599849, 19600026-19600124,19600745-19600823,19600897-19601045, 19601334-19601393,19601490-19601684 Length = 571 Score = 24.2 bits (50), Expect(2) = 7.1 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 10 GGGGGGGGGVKQ 21 Score = 22.6 bits (46), Expect(2) = 7.1 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 8 GDGGGGGGGG 17 >02_05_1164 + 34628391-34628663,34628763-34628816,34628906-34629197, 34629316-34629764 Length = 355 Score = 24.6 bits (51), Expect(2) = 7.4 Identities = 9/13 (69%), Positives = 10/13 (76%) Frame = -1 Query: 854 GGGGGGGXGXXQV 816 GGGGGGG G Q+ Sbjct: 258 GGGGGGGGGVLQL 270 Score = 22.2 bits (45), Expect(2) = 7.4 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 256 GRGGGGGGGG 265 >10_08_0922 - 21593030-21593225,21593319-21594142 Length = 339 Score = 23.4 bits (48), Expect(2) = 7.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 829 PXPPPPPP 852 P PPPPPP Sbjct: 183 PPPPPPPP 190 Score = 23.4 bits (48), Expect(2) = 7.4 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 231 PPPPPPQP 238 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 23.4 bits (48), Expect(2) = 7.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 829 PXPPPPPP 852 P PPPPPP Sbjct: 9 PPPPPPPP 16 Score = 23.4 bits (48), Expect(2) = 7.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 P PPPPPP Sbjct: 25 PKPPPPPP 32 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 25.4 bits (53), Expect(2) = 7.6 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = +1 Query: 793 CXXSXPLIT*XXPXPPPPPP 852 C S + P PPPPPP Sbjct: 203 CGCSHAFVCVCKPAPPPPPP 222 Score = 21.4 bits (43), Expect(2) = 7.6 Identities = 8/10 (80%), Positives = 8/10 (80%), Gaps = 2/10 (20%) Frame = +1 Query: 835 PPPP--PPPP 858 PPPP PPPP Sbjct: 245 PPPPVCPPPP 254 >06_01_0494 + 3539804-3539949,3540466-3540826 Length = 168 Score = 23.4 bits (48), Expect(2) = 8.0 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = +1 Query: 793 CXXSXPLIT*XXPXPPPPPPP 855 C S P ++ PPPPPP Sbjct: 68 CSISPPHLSLHNAQYPPPPPP 88 Score = 23.4 bits (48), Expect(2) = 8.0 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 83 PPPPPPSP 90 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 857 GGGGGGGGXGXXQVMXGXE 801 GGGGGGGG G + G E Sbjct: 88 GGGGGGGGAGDWPLFSGAE 106 >02_02_0087 - 6650570-6652021 Length = 483 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -1 Query: 857 GGGGGGGGXGXXQVMXGXEXXHV 789 GGGGGGGG +++ G + HV Sbjct: 9 GGGGGGGGKFMSRMVTGQKPIHV 31 >07_01_0466 - 3518315-3521428 Length = 1037 Score = 23.4 bits (48), Expect(2) = 8.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPP PP Sbjct: 146 PPPPPEPP 153 Score = 23.0 bits (47), Expect(2) = 8.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPP Sbjct: 142 PVAPPPPPP 150 >07_01_0725 - 5532803-5533324,5533631-5533657,5534285-5534398, 5534564-5534731,5535951-5536193,5537178-5537261, 5537357-5538117,5539637-5539730,5540633-5540899, 5541311-5541316,5542538-5542657 Length = 801 Score = 23.4 bits (48), Expect(2) = 8.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 235 GGGGGGGG 242 Score = 23.0 bits (47), Expect(2) = 8.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 257 GGGGGGGGG 265 >05_07_0035 - 27221338-27221433,27221510-27221599,27222056-27222115, 27222231-27222523,27222601-27222757,27222917-27223261, 27223890-27224020,27224119-27224596,27224817-27225563 Length = 798 Score = 23.4 bits (48), Expect(2) = 8.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 78 PPPPPPAP 85 Score = 23.0 bits (47), Expect(2) = 8.9 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPP Sbjct: 75 PAAPPPPPP 83 >03_01_0648 - 4749150-4749275,4749902-4749986,4750761-4750861, 4750933-4751191,4751382-4751434,4752828-4752990, 4753181-4754616 Length = 740 Score = 24.2 bits (50), Expect(2) = 9.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 854 GGGGGGGXGXXQ 819 GGGGGGG G Q Sbjct: 38 GGGGGGGGGAAQ 49 Score = 22.2 bits (45), Expect(2) = 9.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 36 GRGGGGGGGG 45 >01_06_1790 - 39888313-39888350,39888437-39888530,39888612-39888836, 39888944-39889018,39889144-39889212,39889319-39889384, 39889492-39889713,39889794-39890681,39890973-39891053, 39892546-39892598,39893010-39893088,39893218-39893319 Length = 663 Score = 23.4 bits (48), Expect(2) = 9.1 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 276 GGGGGGGG 283 Score = 23.0 bits (47), Expect(2) = 9.1 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 319 GGGGGGGYG 327 >12_01_0410 - 3234836-3234958,3235636-3235776,3235899-3235949, 3236045-3236125,3236427-3236483,3236898-3236993, 3237204-3237379,3237630-3237703,3237909-3238016, 3238100-3238236,3238396-3238446,3239032-3239142, 3239291-3239363,3240322-3240398,3240641-3240706, 3241349-3241463,3242255-3242511 Length = 597 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = -1 Query: 854 GGGGGGGXGXXQV 816 GGGGGGG G + Sbjct: 39 GGGGGGGAGGLNI 51 Score = 23.0 bits (47), Expect(2) = 9.2 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 GG GGGGG G Sbjct: 36 GGSGGGGGGG 45 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 23.4 bits (48), Expect(2) = 9.2 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 53 GGGGGGGG 60 Score = 23.0 bits (47), Expect(2) = 9.2 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 91 GGGGGGGYG 99 >01_01_0347 + 2765517-2767109,2767214-2767228 Length = 535 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 854 GGGGGGGXGXXQV 816 GGGGGGG G ++ Sbjct: 49 GGGGGGGGGDREL 61 Score = 23.0 bits (47), Expect(2) = 9.3 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 47 GAGGGGGGGG 56 >09_04_0130 - 14905044-14905505,14905865-14905933,14906000-14906104, 14906625-14906690,14907080-14907268,14907353-14907439, 14907597-14908118 Length = 499 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 96 GGGGGGGG 103 Score = 23.0 bits (47), Expect(2) = 9.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 137 GGGGGGGDG 145 >01_01_0570 - 4231100-4232560 Length = 486 Score = 23.4 bits (48), Expect(2) = 9.3 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 88 GGGGGGGG 95 Score = 23.0 bits (47), Expect(2) = 9.3 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 115 GGGGGGGVG 123 >11_06_0326 - 22382001-22383248 Length = 415 Score = 23.4 bits (48), Expect(2) = 9.5 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPPP P Sbjct: 266 PPPPPPAP 273 Score = 23.0 bits (47), Expect(2) = 9.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPP Sbjct: 263 PRAPPPPPP 271 >10_08_0930 - 21641818-21642240,21642731-21642820,21642902-21642984, 21643512-21643605,21644366-21644488,21644893-21645168 Length = 362 Score = 23.8 bits (49), Expect(2) = 9.6 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -1 Query: 854 GGGGGGGXGXXQVMXG 807 GGGGGGG Q+ G Sbjct: 17 GGGGGGGGALLQLRRG 32 Score = 22.6 bits (46), Expect(2) = 9.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 GGGG GGG G Sbjct: 12 GGGGDGGGGG 21 >06_03_0775 - 24510624-24510655,24511228-24512179 Length = 327 Score = 23.4 bits (48), Expect(2) = 9.7 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 835 PPPPPPPP 858 PPPPP PP Sbjct: 221 PPPPPSPP 228 Score = 23.0 bits (47), Expect(2) = 9.7 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +1 Query: 829 PXPPPPPPP 855 P PPPPPP Sbjct: 180 PEKPPPPPP 188 >03_02_0553 - 9420960-9421164,9421634-9421812,9421902-9421970, 9422452-9422607,9422756-9422968 Length = 273 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 33 GGGGGGGG 40 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 43 GGGGGGGVG 51 >12_01_0841 - 7873458-7874225 Length = 255 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 72 GGGGGGGG 79 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 107 GGGGGGGG 114 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 146 GGGGGGGG 153 Score = 23.4 bits (48), Expect(2) = 9.9 Identities = 8/8 (100%), Positives = 8/8 (100%) Frame = -1 Query: 857 GGGGGGGG 834 GGGGGGGG Sbjct: 185 GGGGGGGG 192 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 107 GGGGGGGGG 115 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 146 GGGGGGGGG 154 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 185 GGGGGGGGG 193 Score = 23.0 bits (47), Expect(2) = 9.9 Identities = 8/9 (88%), Positives = 8/9 (88%) Frame = -1 Query: 854 GGGGGGGXG 828 GGGGGGG G Sbjct: 224 GGGGGGGGG 232 >04_03_0960 - 21257219-21257953 Length = 244 Score = 23.4 bits (48), Expect(2) = 10.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = -1 Query: 854 GGGGGGGXGXXQV 816 GGGGGGG G V Sbjct: 211 GGGGGGGGGGAPV 223 Score = 23.0 bits (47), Expect(2) = 10.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -1 Query: 857 GGGGGGGGXG 828 G GGGGGG G Sbjct: 209 GAGGGGGGGG 218 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,895,180 Number of Sequences: 37544 Number of extensions: 497101 Number of successful extensions: 17093 Number of sequences better than 10.0: 192 Number of HSP's better than 10.0 without gapping: 4111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11481 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -