SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_P09
         (860 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr...    27   0.29 
DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chlor...    26   0.51 
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              23   2.7  
AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor p...    22   8.4  
AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.              22   8.4  

>AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor
            protein.
          Length = 1370

 Score = 26.6 bits (56), Expect = 0.29
 Identities = 8/8 (100%), Positives = 8/8 (100%)
 Frame = +1

Query: 835  PPPPPPPP 858
            PPPPPPPP
Sbjct: 1355 PPPPPPPP 1362



 Score = 23.4 bits (48), Expect = 2.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 829  PXPPPPPP 852
            P PPPPPP
Sbjct: 1355 PPPPPPPP 1362


>DQ667187-1|ABG75739.1|  428|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 428

 Score = 25.8 bits (54), Expect = 0.51
 Identities = 8/10 (80%), Positives = 8/10 (80%)
 Frame = +1

Query: 829 PXPPPPPPPP 858
           P P PPPPPP
Sbjct: 339 PKPAPPPPPP 348



 Score = 22.6 bits (46), Expect = 4.8
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +1

Query: 829 PXPPPPPPPP 858
           P  P PPPPP
Sbjct: 338 PPKPAPPPPP 347


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 23.4 bits (48), Expect = 2.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 829  PXPPPPPP 852
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864



 Score = 23.4 bits (48), Expect = 2.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = +1

Query: 835  PPPPPPPP 858
            P PPPPPP
Sbjct: 1857 PEPPPPPP 1864


>AJ547798-1|CAD67999.1|  587|Apis mellifera octopamine receptor
           protein.
          Length = 587

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 13/39 (33%), Positives = 16/39 (41%)
 Frame = -1

Query: 287 TSTTAPSSCRPSVAFRWQGWTKANVCPTCFPERKXLKGS 171
           T    PS C  +      G T + +CPT  P    LK S
Sbjct: 357 TLERTPSKCSQTSVHYSNGQTHSQLCPT--PRSTHLKVS 393


>AB231585-1|BAE17127.1|  898|Apis mellifera Mahya protein.
          Length = 898

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 7/13 (53%), Positives = 8/13 (61%)
 Frame = -1

Query: 293 WGTSTTAPSSCRP 255
           WG     PS+CRP
Sbjct: 512 WGILVYEPSACRP 524


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 210,482
Number of Sequences: 438
Number of extensions: 4755
Number of successful extensions: 19
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27795333
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -