BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P08 (889 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera... 78 3e-13 UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Re... 75 2e-12 UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Re... 58 4e-07 UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecro... 44 0.004 UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera... 44 0.007 UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor... 37 0.79 UniRef50_Q8MUF4 Cluster: Cecropin-B precursor; n=18; Culicidae|R... 35 2.4 UniRef50_Q5W8G6 Cluster: Cecropin; n=1; Acalolepta luxuriosa|Rep... 33 7.4 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 28 7.6 UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, peripla... 27 8.5 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 27 9.8 >UniRef50_P04142 Cluster: Cecropin-B precursor; n=16; Obtectomera|Rep: Cecropin-B precursor - Bombyx mori (Silk moth) Length = 63 Score = 78.2 bits (184), Expect = 3e-13 Identities = 34/63 (53%), Positives = 43/63 (68%) Frame = +2 Query: 125 MNFVRIXXXXXXXXXXXXXXXXXPEPRWKLFKKIEKVGRNVRDGLIKAGPAIAVIGXAKS 304 MNF +I PEPRWK+FKKIEK+GRN+RDG++KAGPAI V+G AK+ Sbjct: 1 MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKA 60 Query: 305 LGK 313 +GK Sbjct: 61 IGK 63 >UniRef50_P01507 Cluster: Cecropin-A precursor; n=17; Ditrysia|Rep: Cecropin-A precursor - Hyalophora cecropia (Cecropia moth) Length = 64 Score = 74.9 bits (176), Expect = 2e-12 Identities = 34/63 (53%), Positives = 41/63 (65%) Frame = +2 Query: 125 MNFVRIXXXXXXXXXXXXXXXXXPEPRWKLFKKIEKVGRNVRDGLIKAGPAIAVIGXAKS 304 MNF RI PEP+WKLFKKIEKVG+N+RDG+IKAGPA+AV+G A Sbjct: 1 MNFSRIFFFVFACLTALAMVNAAPEPKWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQ 60 Query: 305 LGK 313 + K Sbjct: 61 IAK 63 >UniRef50_A6BMG0 Cluster: Cecropin A; n=1; Plutella xylostella|Rep: Cecropin A - Plutella xylostella (Diamondback moth) Length = 66 Score = 57.6 bits (133), Expect = 4e-07 Identities = 26/41 (63%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +2 Query: 200 PRWKLFKKIEKVGRNVRDGLIK-AGPAIAVIGXAKSLGK*T 319 PRWK FKK+EKVGRN+R+G+I+ GPA+AVIG A S+ + T Sbjct: 24 PRWKPFKKLEKVGRNIRNGIIRYNGPAVAVIGQATSIARPT 64 >UniRef50_P01511 Cluster: Cecropin-D; n=6; Obtectomera|Rep: Cecropin-D - Antheraea pernyi (Chinese oak silk moth) Length = 36 Score = 44.4 bits (100), Expect = 0.004 Identities = 17/36 (47%), Positives = 25/36 (69%) Frame = +2 Query: 206 WKLFKKIEKVGRNVRDGLIKAGPAIAVIGXAKSLGK 313 W FK++E+ G+ VRD +I AGPA+A + A +L K Sbjct: 1 WNPFKELERAGQRVRDAIISAGPAVATVAQATALAK 36 >UniRef50_Q2WGL2 Cluster: Antibacterial peptide; n=4; Obtectomera|Rep: Antibacterial peptide - Bombyx mori (Silk moth) Length = 66 Score = 43.6 bits (98), Expect = 0.007 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +2 Query: 206 WKLFKKIEKVGRNVRDGLIKAGPAIAVIGXAKSL 307 W FK++E VG+ VRD +I AGPAI V+ AK L Sbjct: 23 WDFFKELEGVGQRVRDSIISAGPAIDVLQKAKGL 56 >UniRef50_P48821 Cluster: Antibacterial peptide enbocin precursor; n=5; Ditrysia|Rep: Antibacterial peptide enbocin precursor - Bombyx mori (Silk moth) Length = 59 Score = 36.7 bits (81), Expect = 0.79 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 206 WKLFKKIEKVGRNVRDGLIKAGPAIAVIGXAKSL 307 W +FK+IE+ RD +I AGPA+ + A S+ Sbjct: 23 WNIFKEIERAVARTRDAVISAGPAVRTVAAATSV 56 >UniRef50_Q8MUF4 Cluster: Cecropin-B precursor; n=18; Culicidae|Rep: Cecropin-B precursor - Anopheles gambiae (African malaria mosquito) Length = 60 Score = 35.1 bits (77), Expect = 2.4 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +2 Query: 200 PRWKLFKKIEKVGRNVRDGLIKAGPAIA 283 PRWK K++EK+GRNV KA P IA Sbjct: 27 PRWKFGKRLEKLGRNVFRAAKKALPVIA 54 >UniRef50_Q5W8G6 Cluster: Cecropin; n=1; Acalolepta luxuriosa|Rep: Cecropin - Acalolepta luxuriosa (Udo longicorn beetle) Length = 60 Score = 33.5 bits (73), Expect = 7.4 Identities = 15/34 (44%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = +2 Query: 215 FKKIEKVGRNVRDGLIKAGP-AIAVIGXAKSLGK 313 FK+IEKVG+N+R+ ++ P + G AK +GK Sbjct: 27 FKRIEKVGKNIRNAAERSLPTVVGYAGVAKQIGK 60 >UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=2; Ostreococcus|Rep: RhoA GTPase effector DIA/Diaphanous - Ostreococcus tauri Length = 1105 Score = 28.3 bits (60), Expect(2) = 7.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 469 PPPPPPPPPPPP 480 Score = 23.8 bits (49), Expect(2) = 7.6 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 627 ILFXPPPXXPPPP 665 +L PPP PPPP Sbjct: 425 VLPGPPPPPPPPP 437 >UniRef50_Q1DFL6 Cluster: Ferric siderophore transporter, periplasmic energy transduction protein TonB; n=1; Myxococcus xanthus DK 1622|Rep: Ferric siderophore transporter, periplasmic energy transduction protein TonB - Myxococcus xanthus (strain DK 1622) Length = 269 Score = 26.6 bits (56), Expect(2) = 8.5 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 627 ILFXPPPXXPPPP 665 ++F PPP PPPP Sbjct: 63 VVFRPPPPPPPPP 75 Score = 25.4 bits (53), Expect(2) = 8.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 639 PPPXXPPPPXP 671 PPP PPPP P Sbjct: 81 PPPPPPPPPKP 91 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 26.6 bits (56), Expect(2) = 9.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 630 LFXPPPXXPPPP 665 LF PPP PPPP Sbjct: 1253 LFPPPPPPPPPP 1264 Score = 25.0 bits (52), Expect(2) = 9.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 P P PPPP PP Sbjct: 1282 PQPQAPPPPPPP 1293 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 635,947,590 Number of Sequences: 1657284 Number of extensions: 10726731 Number of successful extensions: 74547 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 35574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64008 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 79932179145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -