BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P08 (889 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 0.65 10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 31 1.2 06_03_1153 - 28047125-28047751 31 1.2 12_02_1119 + 26213719-26213955,26214039-26214197,26214640-262147... 25 1.3 08_01_0060 - 413088-413999 31 1.6 08_02_1237 + 25475219-25475916,25476127-25476320,25476407-254773... 30 2.1 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 28 3.3 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 29 3.7 08_02_0796 - 21300251-21300373,21300846-21301721 29 3.7 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 29 3.7 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 29 3.7 08_02_1431 + 27057706-27057900,27058701-27058815,27059123-270591... 29 4.9 07_01_0753 - 5799733-5799741,5799938-5800642 29 4.9 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 4.9 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 29 4.9 02_04_0127 + 19992651-19993334,19993853-19993885,19994060-199941... 29 4.9 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 29 6.5 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 29 6.5 12_01_0442 + 3495333-3496484 25 7.6 12_02_1174 - 26696869-26698191 28 8.6 12_02_1070 - 25814741-25815850 28 8.6 12_02_0326 + 17555731-17556387 28 8.6 12_02_0299 - 17051570-17052474,17053542-17053755 28 8.6 12_01_0495 - 3935395-3937110 28 8.6 11_06_0016 - 19284810-19284926,19285527-19286879 28 8.6 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 28 8.6 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 28 8.6 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 28 8.6 09_06_0148 - 21214460-21214561,21214993-21215339,21215428-212155... 28 8.6 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 28 8.6 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 28 8.6 09_04_0324 - 16686872-16687074,16687479-16687521,16687735-166880... 28 8.6 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 28 8.6 09_02_0327 - 7284829-7284889,7284946-7286126 28 8.6 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 28 8.6 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 28 8.6 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 28 8.6 07_03_1771 - 29404972-29405175,29405282-29405677 28 8.6 07_03_1182 - 24610862-24611637,24612223-24612340,24612441-246141... 28 8.6 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 28 8.6 07_03_0154 + 14509979-14512033 28 8.6 07_01_0080 + 587674-588510 28 8.6 06_03_0696 + 23617687-23617851,23618838-23619536 28 8.6 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 28 8.6 05_07_0031 - 27183252-27183317,27183542-27184282 28 8.6 05_01_0380 + 2978256-2979284 28 8.6 04_04_1687 - 35365766-35366356,35367137-35368135 28 8.6 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 28 8.6 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 28 8.6 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 28 8.6 04_01_0354 - 4646826-4647314 28 8.6 04_01_0197 + 2323790-2324098,2324145-2324774 28 8.6 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 28 8.6 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 28 8.6 03_06_0599 + 34984869-34985319,34986581-34987563 28 8.6 03_06_0365 - 33399422-33399925,33400470-33400583,33400762-334009... 28 8.6 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 28 8.6 03_01_0515 - 3864796-3865425 28 8.6 02_05_0239 + 27101440-27101904 28 8.6 02_03_0279 + 17250347-17252098 28 8.6 01_06_1827 + 40169001-40169263,40169358-40169472,40170090-401702... 28 8.6 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 28 8.6 01_06_1321 + 36280691-36281269 28 8.6 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 28 8.6 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 28 8.6 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 28 8.6 01_05_0423 + 22032940-22033695 28 8.6 01_01_0046 - 331758-332627 28 8.6 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 30.3 bits (65), Expect = 2.1 Identities = 10/14 (71%), Positives = 10/14 (71%) Frame = +3 Query: 633 FXPPPXXPPPPXPP 674 F PPP PPPP PP Sbjct: 561 FSPPPPPPPPPPPP 574 Score = 25.4 bits (53), Expect(2) = 3.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 639 PPPXXPPPPXP 671 PPP PPPP P Sbjct: 566 PPPPPPPPPLP 576 Score = 25.4 bits (53), Expect(3) = 0.65 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 639 PPPXXPPPPXP 671 PPP PPPP P Sbjct: 618 PPPPPPPPPLP 628 Score = 25.4 bits (53), Expect(2) = 5.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 642 PPXXPPPPXPP 674 PP PPPP PP Sbjct: 689 PPPPPPPPLPP 699 Score = 22.6 bits (46), Expect(2) = 3.2 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 645 PXXPPPPXPP 674 P PPPP PP Sbjct: 600 PSPPPPPPPP 609 Score = 22.6 bits (46), Expect(3) = 0.65 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 645 PXXPPPPXPP 674 P PPPP PP Sbjct: 663 PAPPPPPPPP 672 Score = 21.8 bits (44), Expect(2) = 5.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 633 FXPPPXXPPPP 665 F PP PPPP Sbjct: 662 FPAPPPPPPPP 672 Score = 20.6 bits (41), Expect(3) = 0.65 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 630 LFXPPPXXPPPP 665 L PP PPPP Sbjct: 598 LVPSPPPPPPPP 609 >10_06_0152 - 11280532-11281427,11281501-11281971,11282512-11282569 Length = 474 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 +F PPP PPPP PP Sbjct: 318 MFPPPPPPPPPPVPP 332 >06_03_1153 - 28047125-28047751 Length = 208 Score = 31.1 bits (67), Expect = 1.2 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 +F PPP PPPP PP Sbjct: 14 IFCPPPLSPPPPPPP 28 >12_02_1119 + 26213719-26213955,26214039-26214197,26214640-26214702, 26214813-26214902,26214984-26215106,26215344-26215431, 26217043-26217117,26218109-26218215 Length = 313 Score = 25.0 bits (52), Expect(2) = 1.3 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 627 ILFXPPPXXPPPP 665 +L PPP PPPP Sbjct: 10 LLLRPPPPPPPPP 22 Score = 24.6 bits (51), Expect(2) = 1.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPP PP Sbjct: 16 PPPPPPPPNSPP 27 >08_01_0060 - 413088-413999 Length = 303 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 618 HX*ILFXPPPXXPPPPXPP 674 H +LF PP PPPP PP Sbjct: 21 HHPLLFDQPPPPPPPPPPP 39 >08_02_1237 + 25475219-25475916,25476127-25476320,25476407-25477302, 25477416-25477490,25477582-25477689,25477780-25477897, 25478007-25478142,25478228-25478372,25478460-25479080, 25479166-25479597 Length = 1140 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = -1 Query: 673 GGXGGGGXXGGGXNSIXLCXI 611 GG GGGG GGG S +C + Sbjct: 169 GGGGGGGNSGGGGGSYPMCQV 189 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 238 PPPPPPPPPLPP 249 Score = 25.4 bits (53), Expect(2) = 3.3 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 639 PPPXXPPPPXP 671 PPP PPPP P Sbjct: 310 PPPPPPPPPMP 320 Score = 22.6 bits (46), Expect(2) = 3.3 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 645 PXXPPPPXPP 674 P PPPP PP Sbjct: 339 PPAPPPPPPP 348 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.5 bits (63), Expect = 3.7 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 627 ILFXPPPXXPPPPXPP 674 ++ PPP PPPP PP Sbjct: 35 VVIAPPPPPPPPPPPP 50 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 627 ILFXPPPXXPPPPXPP 674 +L PPP PPPP PP Sbjct: 99 LLALPPPPPPPPPPPP 114 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 104 PPPPPPPPPPPP 115 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 105 PPPPPPPPPPPP 116 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 627 ILFXPPPXXPPPPXPP 674 IL PPP PPPP PP Sbjct: 95 ILPPPPPELPPPPPPP 110 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 L PPP PPPP PP Sbjct: 351 LMPPPPPPPPPPPPP 365 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 355 PPPPPPPPPPPP 366 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 356 PPPPPPPPPPPP 367 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 357 PPPPPPPPPPPP 368 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 358 PPPPPPPPPPPP 369 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 359 PPPPPPPPPPPP 370 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 360 PPPPPPPPPPPP 371 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 363 PPPPPPPPPRPP 374 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 368 PPPPRPPPPPPP 379 >08_02_1431 + 27057706-27057900,27058701-27058815,27059123-27059170, 27059272-27059524,27059689-27059776,27059883-27059948, 27060335-27060403,27060492-27060597,27060639-27060793, 27061208-27061537 Length = 474 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +3 Query: 627 ILFXPPPXXPPPPXPP 674 +L PPP PPPP PP Sbjct: 458 LLRLPPPRLPPPPQPP 473 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 633 FXPPPXXPPPPXPP 674 + PPP PPPP PP Sbjct: 41 YAPPPPPPPPPPPP 54 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 L PPP PPPP PP Sbjct: 546 LVGPPPPPPPPPPPP 560 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 29.1 bits (62), Expect = 4.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 633 FXPPPXXPPPPXPP 674 + PPP PPPP PP Sbjct: 426 YAPPPPPPPPPPPP 439 >02_04_0127 + 19992651-19993334,19993853-19993885,19994060-19994128, 19994494-19994581,19994627-19995132,19995210-19995503, 19995557-19995906,19996020-19996456,19996718-19996743, 19996995-19997078 Length = 856 Score = 29.1 bits (62), Expect = 4.9 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -1 Query: 670 GXGGGGXXGGGXNSIXLCXIYK 605 G GGGG GGG S L IYK Sbjct: 18 GRGGGGGGGGGDASAALSFIYK 39 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 L PPP PPPP PP Sbjct: 576 LAQPPPPPPPPPPPP 590 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 L PPP PPPP PP Sbjct: 36 LCPPPPPPPPPPPPP 50 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 40 PPPPPPPPPPPP 51 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 41 PPPPPPPPPPPP 52 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 42 PPPPPPPPPPPP 53 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 43 PPPPPPPPPPPP 54 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 44 PPPPPPPPPPPP 55 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 45 PPPPPPPPPPPP 56 >12_01_0442 + 3495333-3496484 Length = 383 Score = 25.4 bits (53), Expect(2) = 7.6 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 630 LFXPPPXXPPPP 665 +F PPP PPPP Sbjct: 67 VFRPPPPPPPPP 78 Score = 21.4 bits (43), Expect(2) = 7.6 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPP P Sbjct: 71 PPPPPPPPAKNP 82 >12_02_1174 - 26696869-26698191 Length = 440 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 148 PPPSLPPPPPPP 159 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 153 PPPPPPPPPPPP 164 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 154 PPPPPPPPPPPP 165 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 157 PPPPPPPPPRPP 168 >12_02_1070 - 25814741-25815850 Length = 369 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 237 PPPPPPPPPPPP 248 >12_02_0326 + 17555731-17556387 Length = 218 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 204 PPPALPPPPPPP 215 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 320 PPPPPPPPPPPP 331 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 321 PPPPPPPPPPPP 332 >12_01_0495 - 3935395-3937110 Length = 571 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 5 PPPPLPPPPPPP 16 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 6 PPPLPPPPPPPP 17 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 83 PPPSPPPPPPPP 94 >10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 Length = 190 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 17 PPPTPPPPPAPP 28 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 327 PPPAPPPPPPPP 338 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 338 PPPPPPPPPPPP 349 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 339 PPPPPPPPPPPP 350 >09_06_0148 - 21214460-21214561,21214993-21215339,21215428-21215538, 21215673-21215835,21215921-21215999,21216110-21216228 Length = 306 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 199 PPPAAPPPPPPP 210 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 82 PPPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 83 PPPPPPPPPPPP 94 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 84 PPPPPPPPPPPP 95 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 264 PPPPPPPPPPPP 275 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 265 PPPPPPPPPPPP 276 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 268 PPPPPPPPPMPP 279 >09_04_0324 - 16686872-16687074,16687479-16687521,16687735-16688068, 16688190-16688854 Length = 414 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 3 PPPPSPPPPSPP 14 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 14 PPPPPPPPPPPP 25 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 15 PPPPPPPPPPPP 26 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 16 PPPPPPPPPPPP 27 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 53 PPPPPPPPPPPP 64 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 54 PPPPPPPPPPPP 65 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 55 PPPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 56 PPPPPPPPPPPP 67 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 426 PPPPLPPPPPPP 437 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 427 PPPLPPPPPPPP 438 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 431 PPPPPPPPPPPP 442 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 432 PPPPPPPPPPPP 443 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 435 PPPPPPPPPLPP 446 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 106 PPPPPPPPPSPP 117 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 116 PPPSAPPPPPPP 127 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 20 PPPPPPPPPLPP 31 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 17 PPPPPPPPPLPP 28 >07_03_1182 - 24610862-24611637,24612223-24612340,24612441-24614120, 24614253-24614320,24615370-24615550 Length = 940 Score = 28.3 bits (60), Expect = 8.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = -2 Query: 204 LGSGAALTAPRASTNAKTKLKIRTKFILPKFYSARRIQNSKYNI 73 L G T PR+S+N + +K +L K +S +NS +I Sbjct: 56 LPPGPGHTLPRSSSNVAAQSSSTSKIVLEKTFSKSMTENSSLSI 99 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 63 PPPPPPPPPQPP 74 >07_03_0154 + 14509979-14512033 Length = 684 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 53 PPPPPPPPPPPP 64 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 54 PPPPPPPPPPPP 65 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 55 PPPPPPPPPPPP 66 >07_01_0080 + 587674-588510 Length = 278 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 104 PPPPPPPPPPPP 115 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 105 PPPPPPPPPPPP 116 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 106 PPPPPPPPPPPP 117 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 107 PPPPPPPPPPPP 118 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 108 PPPPPPPPPPPP 119 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 109 PPPPPPPPPPPP 120 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 110 PPPPPPPPPPPP 121 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 79 PPPPPPPPPSPP 90 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 1926 PPPHAPPPPPPP 1937 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 117 PPPPPPPPPPPP 128 >05_01_0380 + 2978256-2979284 Length = 342 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 26 PPPPPPPPPPPP 37 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 27 PPPPPPPPPPPP 38 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 28 PPPPPPPPPPPP 39 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 29 PPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 30 PPPPPPPPPPPP 41 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 10 PPPPPPPPPPPP 21 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 11 PPPPPPPPPPPP 22 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 12 PPPPPPPPPPPP 23 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 26 PPPPPPPPPPPP 37 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 30 PPPSDPPPPPPP 41 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 365 PPPPPPPPPPPP 376 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 366 PPPPPPPPPPPP 377 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 367 PPPPPPPPPPPP 378 >04_01_0354 - 4646826-4647314 Length = 162 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 93 PPPPPPPPPPPP 104 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 27 PPPPPPPPPPPP 38 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 28 PPPPPPPPPPPP 39 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 29 PPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 30 PPPPPPPPPPPP 41 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 277 PPPAGPPPPAPP 288 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 355 PPPPPPPPPPPP 366 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 399 PPPPQPPPPPPP 410 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 400 PPPQPPPPPPPP 411 >03_06_0365 - 33399422-33399925,33400470-33400583,33400762-33400929, 33401305-33401547,33402148-33402231,33402323-33403098, 33404423-33404636 Length = 700 Score = 28.3 bits (60), Expect = 8.6 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -1 Query: 673 GGXGGGGXXGGGXNS 629 GG GGGG GGG NS Sbjct: 167 GGRGGGGGGGGGWNS 181 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 349 PPPPPPPPPPPP 360 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 350 PPPPPPPPPPPP 361 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 351 PPPPPPPPPPPP 362 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 352 PPPPPPPPPPPP 363 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 353 PPPPPPPPPPPP 364 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 354 PPPPPPPPPPPP 365 >03_01_0515 - 3864796-3865425 Length = 209 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 84 PPPPLPPPPPPP 95 >02_05_0239 + 27101440-27101904 Length = 154 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 39 PPPDPPPPPTPP 50 >02_03_0279 + 17250347-17252098 Length = 583 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 124 PPPPPPPPPPPP 135 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 125 PPPPPPPPPPPP 136 >01_06_1827 + 40169001-40169263,40169358-40169472,40170090-40170201, 40170556-40170623,40170798-40170852,40170948-40171027, 40171811-40171924,40172178-40172296,40173064-40173181, 40173264-40173394,40173535-40173688,40173922-40174017 Length = 474 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 35 PPPPAPPPPPPP 46 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 422 PPPPPPPPPPPP 433 >01_06_1321 + 36280691-36281269 Length = 192 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 143 PPPSPPPPPPPP 154 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 148 PPPPPPPPPLPP 159 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 43 PPPGVPPPPPPP 54 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 5 PPPPPPPPPSPP 16 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 76 PPPPPPPPPPPP 87 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 77 PPPPPPPPPPPP 88 >01_05_0423 + 22032940-22033695 Length = 251 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 24 PPPQPPPPPPPP 35 >01_01_0046 - 331758-332627 Length = 289 Score = 28.3 bits (60), Expect = 8.6 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 21 PPPPPPPPPPPP 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,697,222 Number of Sequences: 37544 Number of extensions: 321660 Number of successful extensions: 6133 Number of sequences better than 10.0: 68 Number of HSP's better than 10.0 without gapping: 2056 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4977 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -