BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P08 (889 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024200-11|AAF36000.1| 271|Caenorhabditis elegans Hypothetical... 30 2.5 AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ... 25 2.8 Z92782-12|CAH60765.1| 328|Caenorhabditis elegans Hypothetical p... 29 4.4 AL032637-18|CAE17998.1| 193|Caenorhabditis elegans Hypothetical... 25 5.7 U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical pr... 29 5.9 Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical pr... 25 6.2 Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr... 28 7.8 Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical p... 28 7.8 Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical p... 28 7.8 Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical pr... 28 7.8 U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (gr... 28 7.8 U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (gr... 28 7.8 U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (gr... 28 7.8 U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical pr... 28 7.8 U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical pr... 28 7.8 U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical pr... 28 7.8 AL032654-7|CAA21719.1| 219|Caenorhabditis elegans Hypothetical ... 28 7.8 >AC024200-11|AAF36000.1| 271|Caenorhabditis elegans Hypothetical protein Y71F9AL.6 protein. Length = 271 Score = 29.9 bits (64), Expect = 2.5 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +2 Query: 395 LRSYLNSIRHFYIYYVTLCYVVPRLY**YLTYHSHCLSQSDRVHI-LLYTIFQIMLAXNI 571 ++S + I H YI Y Y + ++Y Y YH + ++S HI +Y I+ I + + Sbjct: 18 IKSTIYYIYHIYIPYTI--YTIHQIYHIYYIYHIYTYTKSPIYHIHHIYQIYHIHIINTL 75 Query: 572 ELV 580 ++ Sbjct: 76 YII 78 >AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical protein F59E12.9 protein. Length = 1621 Score = 25.4 bits (53), Expect(2) = 2.8 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 639 PPPXXPPPPXP 671 PPP PPPP P Sbjct: 1338 PPPPPPPPPPP 1348 Score = 22.6 bits (46), Expect(2) = 2.8 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 645 PXXPPPPXPP 674 P PPPP PP Sbjct: 1354 PVPPPPPPPP 1363 >Z92782-12|CAH60765.1| 328|Caenorhabditis elegans Hypothetical protein F14F8.13 protein. Length = 328 Score = 29.1 bits (62), Expect = 4.4 Identities = 9/38 (23%), Positives = 22/38 (57%) Frame = +3 Query: 444 HYVMWFLDYISNI*HTTVIAFLRVTECIYYYIPYFKLC 557 H +++ L ++++ + FL + ++ Y+P+F LC Sbjct: 121 HVILFLLAILNSLKYIFSFLFLNIQSSVHKYLPHFTLC 158 >AL032637-18|CAE17998.1| 193|Caenorhabditis elegans Hypothetical protein Y43F8C.20 protein. Length = 193 Score = 24.6 bits (51), Expect(2) = 5.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 673 GGXGGGGXXGGG 638 GG GGGG GGG Sbjct: 89 GGNGGGGRGGGG 100 Score = 22.6 bits (46), Expect(2) = 5.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -1 Query: 664 GGGGXXGGGXNS 629 GGGG GGG N+ Sbjct: 110 GGGGNWGGGGNN 121 >U88172-5|AAB42260.1| 483|Caenorhabditis elegans Hypothetical protein ZK354.8 protein. Length = 483 Score = 28.7 bits (61), Expect = 5.9 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 630 LFXPPPXXPPPPXPP 674 + PPP PPPP PP Sbjct: 89 MMLPPPSDPPPPPPP 103 >Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical protein R08B4.1b protein. Length = 1160 Score = 24.6 bits (51), Expect(2) = 6.2 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 673 GGXGGGGXXGGG 638 GG GGGG GGG Sbjct: 795 GGSGGGGGGGGG 806 Score = 22.2 bits (45), Expect(2) = 6.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 664 GGGGXXGGGXN 632 GGGG GGG N Sbjct: 821 GGGGGNGGGGN 831 >Z93393-1|CAB07688.1| 497|Caenorhabditis elegans Hypothetical protein Y48E1B.1 protein. Length = 497 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 357 PPPPPPPPPPPP 368 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 358 PPPPPPPPPPPP 369 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 359 PPPPPPPPPPPP 370 >Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical protein K02E2.2 protein. Length = 1021 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 787 PPPPVPPPPPPP 798 >Z74031-17|CAN86923.1| 380|Caenorhabditis elegans Hypothetical protein F32D8.7b protein. Length = 380 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 242 PPPTTPPPPPPP 253 >Z74031-16|CAA98452.1| 378|Caenorhabditis elegans Hypothetical protein F32D8.7a protein. Length = 378 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 240 PPPTTPPPPPPP 251 >Z72502-7|CAA96592.1| 140|Caenorhabditis elegans Hypothetical protein C08B6.10 protein. Length = 140 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 121 PPPWGPPPPGPP 132 >U50310-5|AAA92541.1| 318|Caenorhabditis elegans Ground-like (grd related) protein 9 protein. Length = 318 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 135 PPPPSPPPPPPP 146 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 136 PPPSPPPPPPPP 147 >U40799-6|AAA81484.2| 210|Caenorhabditis elegans Ground-like (grd related) protein 4 protein. Length = 210 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 58 PPPMCPPPPPPP 69 >U39852-7|AAK39260.1| 240|Caenorhabditis elegans Ground-like (grd related) protein 6 protein. Length = 240 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 67 PPPICPPPPPPP 78 >U23515-9|AAP82644.1| 360|Caenorhabditis elegans Hypothetical protein R144.4a protein. Length = 360 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 3 PPPPPPPPPPPP 14 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 4 PPPPPPPPPPPP 15 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 5 PPPPPPPPPPPP 16 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 6 PPPPPPPPPPPP 17 >U23515-8|AAP82645.1| 362|Caenorhabditis elegans Hypothetical protein R144.4b protein. Length = 362 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 2 PPPPPPPPPPPP 13 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 3 PPPPPPPPPPPP 14 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 4 PPPPPPPPPPPP 15 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 5 PPPPPPPPPPPP 16 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 6 PPPPPPPPPPPP 17 >U10438-9|AAU87834.1| 616|Caenorhabditis elegans Hypothetical protein B0280.13 protein. Length = 616 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 512 PPPPPPPPPPPP 523 >AL032654-7|CAA21719.1| 219|Caenorhabditis elegans Hypothetical protein Y52B11A.5 protein. Length = 219 Score = 28.3 bits (60), Expect = 7.8 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 639 PPPXXPPPPXPP 674 PPP PPPP PP Sbjct: 29 PPPARPPPPPPP 40 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,732,082 Number of Sequences: 27780 Number of extensions: 266331 Number of successful extensions: 2134 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1878 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -