SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_P08
         (889 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AC024200-11|AAF36000.1|  271|Caenorhabditis elegans Hypothetical...    30   2.5  
AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical ...    25   2.8  
Z92782-12|CAH60765.1|  328|Caenorhabditis elegans Hypothetical p...    29   4.4  
AL032637-18|CAE17998.1|  193|Caenorhabditis elegans Hypothetical...    25   5.7  
U88172-5|AAB42260.1|  483|Caenorhabditis elegans Hypothetical pr...    29   5.9  
Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical pr...    25   6.2  
Z93393-1|CAB07688.1|  497|Caenorhabditis elegans Hypothetical pr...    28   7.8  
Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical pr...    28   7.8  
Z74031-17|CAN86923.1|  380|Caenorhabditis elegans Hypothetical p...    28   7.8  
Z74031-16|CAA98452.1|  378|Caenorhabditis elegans Hypothetical p...    28   7.8  
Z72502-7|CAA96592.1|  140|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U50310-5|AAA92541.1|  318|Caenorhabditis elegans Ground-like (gr...    28   7.8  
U40799-6|AAA81484.2|  210|Caenorhabditis elegans Ground-like (gr...    28   7.8  
U39852-7|AAK39260.1|  240|Caenorhabditis elegans Ground-like (gr...    28   7.8  
U23515-9|AAP82644.1|  360|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U23515-8|AAP82645.1|  362|Caenorhabditis elegans Hypothetical pr...    28   7.8  
U10438-9|AAU87834.1|  616|Caenorhabditis elegans Hypothetical pr...    28   7.8  
AL032654-7|CAA21719.1|  219|Caenorhabditis elegans Hypothetical ...    28   7.8  

>AC024200-11|AAF36000.1|  271|Caenorhabditis elegans Hypothetical
           protein Y71F9AL.6 protein.
          Length = 271

 Score = 29.9 bits (64), Expect = 2.5
 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 395 LRSYLNSIRHFYIYYVTLCYVVPRLY**YLTYHSHCLSQSDRVHI-LLYTIFQIMLAXNI 571
           ++S +  I H YI Y    Y + ++Y  Y  YH +  ++S   HI  +Y I+ I +   +
Sbjct: 18  IKSTIYYIYHIYIPYTI--YTIHQIYHIYYIYHIYTYTKSPIYHIHHIYQIYHIHIINTL 75

Query: 572 ELV 580
            ++
Sbjct: 76  YII 78


>AF003386-9|AAB54259.1| 1621|Caenorhabditis elegans Hypothetical
            protein F59E12.9 protein.
          Length = 1621

 Score = 25.4 bits (53), Expect(2) = 2.8
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = +3

Query: 639  PPPXXPPPPXP 671
            PPP  PPPP P
Sbjct: 1338 PPPPPPPPPPP 1348



 Score = 22.6 bits (46), Expect(2) = 2.8
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = +3

Query: 645  PXXPPPPXPP 674
            P  PPPP PP
Sbjct: 1354 PVPPPPPPPP 1363


>Z92782-12|CAH60765.1|  328|Caenorhabditis elegans Hypothetical
           protein F14F8.13 protein.
          Length = 328

 Score = 29.1 bits (62), Expect = 4.4
 Identities = 9/38 (23%), Positives = 22/38 (57%)
 Frame = +3

Query: 444 HYVMWFLDYISNI*HTTVIAFLRVTECIYYYIPYFKLC 557
           H +++ L  ++++ +     FL +   ++ Y+P+F LC
Sbjct: 121 HVILFLLAILNSLKYIFSFLFLNIQSSVHKYLPHFTLC 158


>AL032637-18|CAE17998.1|  193|Caenorhabditis elegans Hypothetical
           protein Y43F8C.20 protein.
          Length = 193

 Score = 24.6 bits (51), Expect(2) = 5.7
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 673 GGXGGGGXXGGG 638
           GG GGGG  GGG
Sbjct: 89  GGNGGGGRGGGG 100



 Score = 22.6 bits (46), Expect(2) = 5.7
 Identities = 8/12 (66%), Positives = 9/12 (75%)
 Frame = -1

Query: 664 GGGGXXGGGXNS 629
           GGGG  GGG N+
Sbjct: 110 GGGGNWGGGGNN 121


>U88172-5|AAB42260.1|  483|Caenorhabditis elegans Hypothetical
           protein ZK354.8 protein.
          Length = 483

 Score = 28.7 bits (61), Expect = 5.9
 Identities = 9/15 (60%), Positives = 10/15 (66%)
 Frame = +3

Query: 630 LFXPPPXXPPPPXPP 674
           +  PPP  PPPP PP
Sbjct: 89  MMLPPPSDPPPPPPP 103


>Z68008-5|CAD91696.1| 1160|Caenorhabditis elegans Hypothetical
           protein R08B4.1b protein.
          Length = 1160

 Score = 24.6 bits (51), Expect(2) = 6.2
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = -1

Query: 673 GGXGGGGXXGGG 638
           GG GGGG  GGG
Sbjct: 795 GGSGGGGGGGGG 806



 Score = 22.2 bits (45), Expect(2) = 6.2
 Identities = 8/11 (72%), Positives = 8/11 (72%)
 Frame = -1

Query: 664 GGGGXXGGGXN 632
           GGGG  GGG N
Sbjct: 821 GGGGGNGGGGN 831


>Z93393-1|CAB07688.1|  497|Caenorhabditis elegans Hypothetical
           protein Y48E1B.1 protein.
          Length = 497

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 357 PPPPPPPPPPPP 368



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 358 PPPPPPPPPPPP 369



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 359 PPPPPPPPPPPP 370


>Z81560-2|CAB04547.1| 1021|Caenorhabditis elegans Hypothetical
           protein K02E2.2 protein.
          Length = 1021

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 787 PPPPVPPPPPPP 798


>Z74031-17|CAN86923.1|  380|Caenorhabditis elegans Hypothetical
           protein F32D8.7b protein.
          Length = 380

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 242 PPPTTPPPPPPP 253


>Z74031-16|CAA98452.1|  378|Caenorhabditis elegans Hypothetical
           protein F32D8.7a protein.
          Length = 378

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 240 PPPTTPPPPPPP 251


>Z72502-7|CAA96592.1|  140|Caenorhabditis elegans Hypothetical
           protein C08B6.10 protein.
          Length = 140

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 121 PPPWGPPPPGPP 132


>U50310-5|AAA92541.1|  318|Caenorhabditis elegans Ground-like (grd
           related) protein 9 protein.
          Length = 318

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 135 PPPPSPPPPPPP 146



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 136 PPPSPPPPPPPP 147


>U40799-6|AAA81484.2|  210|Caenorhabditis elegans Ground-like (grd
           related) protein 4 protein.
          Length = 210

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 58  PPPMCPPPPPPP 69


>U39852-7|AAK39260.1|  240|Caenorhabditis elegans Ground-like (grd
           related) protein 6 protein.
          Length = 240

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 67  PPPICPPPPPPP 78


>U23515-9|AAP82644.1|  360|Caenorhabditis elegans Hypothetical
           protein R144.4a protein.
          Length = 360

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 2   PPPPPPPPPPPP 13



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 3   PPPPPPPPPPPP 14



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 4   PPPPPPPPPPPP 15



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 5   PPPPPPPPPPPP 16



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 6   PPPPPPPPPPPP 17


>U23515-8|AAP82645.1|  362|Caenorhabditis elegans Hypothetical
           protein R144.4b protein.
          Length = 362

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 2   PPPPPPPPPPPP 13



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 3   PPPPPPPPPPPP 14



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 4   PPPPPPPPPPPP 15



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 5   PPPPPPPPPPPP 16



 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 6   PPPPPPPPPPPP 17


>U10438-9|AAU87834.1|  616|Caenorhabditis elegans Hypothetical
           protein B0280.13 protein.
          Length = 616

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 512 PPPPPPPPPPPP 523


>AL032654-7|CAA21719.1|  219|Caenorhabditis elegans Hypothetical
           protein Y52B11A.5 protein.
          Length = 219

 Score = 28.3 bits (60), Expect = 7.8
 Identities = 9/12 (75%), Positives = 9/12 (75%)
 Frame = +3

Query: 639 PPPXXPPPPXPP 674
           PPP  PPPP PP
Sbjct: 29  PPPARPPPPPPP 40


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,732,082
Number of Sequences: 27780
Number of extensions: 266331
Number of successful extensions: 2134
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 1004
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1878
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2244863852
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -