BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P04 (850 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 32 0.007 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 26 0.33 L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protei... 26 0.33 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 23 2.3 AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation facto... 22 7.0 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 21 9.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 9.3 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 9.3 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 9.3 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 31.9 bits (69), Expect = 0.007 Identities = 9/25 (36%), Positives = 19/25 (76%) Frame = -1 Query: 424 IFSIHMVRHVAVYRFYCLYLKFTIH 350 IF++H++ + +Y F+C ++ FT+H Sbjct: 155 IFTVHLLFLLCIYHFFCAFIIFTMH 179 Score = 28.3 bits (60), Expect = 0.081 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 3/30 (10%) Frame = -1 Query: 421 FSIHMVRHVAVYRFYCLYLKFTIH---YCI 341 F++H++ +Y FY ++ FTIH YC+ Sbjct: 202 FTLHLLFLPCIYYFYSAFIIFTIHLLFYCV 231 Score = 25.8 bits (54), Expect = 0.43 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -1 Query: 397 VAVYRFYCLYLKFTIH 350 + +Y FYC ++ FT+H Sbjct: 144 LCIYYFYCAFIIFTVH 159 Score = 23.0 bits (47), Expect = 3.1 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -1 Query: 382 FYCLYLKFTIHYCI 341 FYC ++ FT+H+ + Sbjct: 85 FYCPFIIFTVHFLL 98 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 26.2 bits (55), Expect = 0.33 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 436 VRCAIFSIHMVRHVAVYRFYCLYLKFTIHYCINL 335 V ++ + HM H VYR+ C + YC +L Sbjct: 269 VNKSMLNSHMKSHSNVYRYSCRDCSYATKYCHSL 302 >L01615-1|AAA30095.1| 69|Tribolium castaneum zinc finger protein protein. Length = 69 Score = 26.2 bits (55), Expect = 0.33 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -1 Query: 436 VRCAIFSIHMVRHVAVYRFYCLYLKFTIHYCINL 335 V ++ + HM H VYR+ C + YC +L Sbjct: 27 VNKSMLNSHMKSHSNVYRYSCRDCSYATKYCHSL 60 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 23.4 bits (48), Expect = 2.3 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = +2 Query: 416 AKNGTSNSARKFFTLKDMPHIVRALDRNQKVHSDILNVIGNTPLVKLSKLPKD 574 AK N+ + TLK + ++ D + +I+ V G+T + K+ +L KD Sbjct: 127 AKFEELNNDQFLKTLKPVKKVLEDADMTKDQIDEIVLVGGSTRIPKIQQLIKD 179 >AY819656-1|AAV70656.1| 56|Tribolium castaneum elongation factor 1-alpha protein. Length = 56 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +3 Query: 675 QKGILKPGKSVIVEPTSGNTGI 740 + G+LKPG V+ P + T + Sbjct: 19 ETGVLKPGMVVVFAPANITTEV 40 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 842 HPMRPGGLLFHLTFSQATX*W 780 HP+ GG++++ F A W Sbjct: 192 HPIGSGGMVWYQMFEYAVGHW 212 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 842 HPMRPGGLLFHLTFSQATX*W 780 HP+ GG++++ F A W Sbjct: 506 HPIGSGGMVWYQMFEYAVGHW 526 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 842 HPMRPGGLLFHLTFSQATX*W 780 HP+ GG++++ F A W Sbjct: 739 HPIGSGGMVWYQMFEYAVGHW 759 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = -3 Query: 842 HPMRPGGLLFHLTFSQATX*W 780 HP+ GG++++ F A W Sbjct: 739 HPIGSGGMVWYQMFEYAVGHW 759 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,894 Number of Sequences: 336 Number of extensions: 4241 Number of successful extensions: 14 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -