BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_P01 (868 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_6351| Best HMM Match : IncA (HMM E-Value=0.13) 30 2.1 SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4) 29 4.9 SB_44985| Best HMM Match : YhjQ (HMM E-Value=0.37) 29 4.9 SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5) 28 8.6 SB_24027| Best HMM Match : FAD_binding_7 (HMM E-Value=0) 28 8.6 SB_19185| Best HMM Match : DUF1269 (HMM E-Value=0.28) 28 8.6 >SB_11523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 32.3 bits (70), Expect = 0.53 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 265 YIGSNLVHFGELLTDLGLADSWFSWM*NIANHLLARQQSVGHEFASANS 119 +I N +F + DLG+A ++ + + +H L R Q+VGH FA S Sbjct: 289 FIDFNDFYFSNRVVDLGIALAYIMMLPQVNSH-LTRPQAVGHMFAGYQS 336 >SB_34297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 512 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/70 (30%), Positives = 34/70 (48%) Frame = -1 Query: 418 FARGPLLLVQAVAG*PVLGLELLGQIECVVDQSESS*FATSEVCLETEYEHYIGSNLVHF 239 F +G L + V ++GLEL +I+ ++D++ S CL +E + N F Sbjct: 56 FFQGDSTLKEPVQKILIIGLELAKEIQKLIDEASSGLNIKHAACLPSEVPAF--CNTERF 113 Query: 238 GELLTDLGLA 209 G LL D+ A Sbjct: 114 GLLLVDVRCA 123 >SB_6351| Best HMM Match : IncA (HMM E-Value=0.13) Length = 417 Score = 30.3 bits (65), Expect = 2.1 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 365 KHRLARHGLYEKKRPTRKQRKERKNRMKKVRGTXKSKV 478 +H LA H +++RP+ R+ K R++K+R S+V Sbjct: 378 RHGLASHDKKKRERPSLVARERMKKRLRKIREEFGSEV 415 >SB_18070| Best HMM Match : V-ATPase_G (HMM E-Value=4) Length = 166 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +2 Query: 365 KHRLARHGLYEKKRPTRKQRKERKNRMKKVR 457 +H LA H +++RP+ R+ K R++K+R Sbjct: 79 RHGLASHDKKKRERPSLVARERMKKRLRKIR 109 >SB_44985| Best HMM Match : YhjQ (HMM E-Value=0.37) Length = 1376 Score = 29.1 bits (62), Expect = 4.9 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = +2 Query: 338 LDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKV 454 LDL KHR RH EKK K RK +KN M+++ Sbjct: 1000 LDLLLAHATKHRGRRHRS-EKKEKANKARKCQKNYMRRL 1037 >SB_32823| Best HMM Match : Late_protein_L1 (HMM E-Value=2.5) Length = 585 Score = 28.3 bits (60), Expect = 8.6 Identities = 23/76 (30%), Positives = 38/76 (50%) Frame = +1 Query: 193 RKTNCQQDRDP*EARQNVQGYSRCSVRIRFQDKLRRWQINWIRFDLRHTRSGQEVRAQAQ 372 R+T+ DR A+ NV S V++R D ++ ++ ++ D R + SGQ+V ++ Sbjct: 281 RRTSQSNDR----AQGNVTVVSTAHVQVRADD-VQAMNVSGVKSDGRPSSSGQDVYDGSR 335 Query: 373 VSPPRPVREEEAHAQT 420 S P E AQT Sbjct: 336 QSTHGPALPWEELAQT 351 >SB_24027| Best HMM Match : FAD_binding_7 (HMM E-Value=0) Length = 1074 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/27 (44%), Positives = 20/27 (74%) Frame = -1 Query: 241 FGELLTDLGLADSWFSWM*NIANHLLA 161 FGEL+ D G + + F+W+ N++N +LA Sbjct: 76 FGELMLDAGWSRNAFNWL-NMSNSMLA 101 >SB_19185| Best HMM Match : DUF1269 (HMM E-Value=0.28) Length = 407 Score = 28.3 bits (60), Expect = 8.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 365 KHRLARHGLYEKKRPTRKQRKERKNRMKKVRGTXKSKV 478 +HRLA +K P+ + R++ K R++++R SKV Sbjct: 368 RHRLAPSDKKSRKGPSPEAREKIKKRLREIREEFGSKV 405 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,356,452 Number of Sequences: 59808 Number of extensions: 439488 Number of successful extensions: 1247 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1232 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2479240863 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -