BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O24 (905 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_0636 + 20168180-20168462,20168961-20170303,20170401-201706... 31 1.7 08_02_0725 - 20442988-20443180,20443268-20443540,20443642-204438... 30 2.2 04_01_0215 - 2728413-2728599,2729794-2730318,2730548-2730755,273... 29 3.8 09_04_0734 + 19796297-19796329,19796866-19797129 29 6.7 07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-57... 29 6.7 03_05_0428 + 24152409-24152783,24152885-24153139,24153204-24153917 29 6.7 02_05_0047 + 25411500-25412867 29 6.7 >07_03_0636 + 20168180-20168462,20168961-20170303,20170401-20170678, 20170790-20170821,20170908-20171314,20171401-20171847 Length = 929 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/45 (35%), Positives = 25/45 (55%) Frame = +3 Query: 138 SFYASWLRREVSDHQPIFKVSPTPSRYSRLCHLGQGNGGREGLRD 272 SF S+L +E++ + +PS Y+R LG GNGG + + D Sbjct: 708 SFARSYLVQELNIAETRLVPLNSPSDYARALELGSGNGGVDAIID 752 >08_02_0725 - 20442988-20443180,20443268-20443540,20443642-20443853, 20443935-20444247,20444334-20444441,20444537-20444643, 20444743-20444781 Length = 414 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -3 Query: 312 TTFTKKSLVALSQSPEDLPSPHFPVPSDKVV 220 TTF +++ A S +PE+LP P + D+VV Sbjct: 233 TTFRRRTTAAASPAPEELPLPRKILDHDRVV 263 >04_01_0215 - 2728413-2728599,2729794-2730318,2730548-2730755, 2730946-2731001,2731294-2731394,2731923-2732150 Length = 434 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 530 VFXPRSHTPEADASIPALPPIACSSQ 453 + P SH P A ++ P LP +A SSQ Sbjct: 241 IVIPTSHAPSAKSASPPLPALAMSSQ 266 >09_04_0734 + 19796297-19796329,19796866-19797129 Length = 98 Score = 28.7 bits (61), Expect = 6.7 Identities = 20/56 (35%), Positives = 23/56 (41%), Gaps = 1/56 (1%) Frame = +1 Query: 238 DREMGGGKVFGTLGESDQGLFGKGGYNREFFNDDRGKLTGQAYGTRVLGP-GGDST 402 + E GGG FG GE G G G + LTG G V G GD+T Sbjct: 35 EEECGGGVSFGAAGEDGHGGDGDGDGVNAYLRFPGPTLTGSGDGGVVGGEVDGDAT 90 >07_01_0077 + 566895-567127,567207-567331,571204-571340,571437-571542, 571635-571885,572018-572128,572209-572320,572626-572716, 573168-573507,573678-573900,573946-574204,574274-574481, 574572-574622,574712-574870,574956-575120,575322-575399, 575732-576031,576107-576259,576871-576918,577019-577188, 577738-577852,578462-578623,578789-578893,578969-579199, 579277-579410,579484-579738,579822-580110,580214-580306, 580395-580520,580646-580897 Length = 1693 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +3 Query: 150 SWLRREVSDHQP-IFKVSPTPSRYSRLCHLGQGNGGREGLRDFGRERP 290 SWL REV H P F + P P S+ GQ N +E + F P Sbjct: 94 SWLWREVLKHNPDAFTIKPRPLPPSQDPLEGQENQNQEHEKHFAHVAP 141 >03_05_0428 + 24152409-24152783,24152885-24153139,24153204-24153917 Length = 447 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/37 (48%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +3 Query: 105 SRCTP-CMRERSSFYASWLRREVSDHQPIFKVSPTPS 212 + CTP RSS YA+ L R S + KVSPTPS Sbjct: 234 AHCTPRTSSRRSSCYATPLCRTPSKVELYQKVSPTPS 270 >02_05_0047 + 25411500-25412867 Length = 455 Score = 28.7 bits (61), Expect = 6.7 Identities = 34/119 (28%), Positives = 52/119 (43%) Frame = -3 Query: 570 TELXRDHSAS*QVSIXTKIPHAGS*CXDPSAATNCXFKSIAAWAFSLAQSRRPPVTGTVA 391 T L R+H VS+ I A SA++ S+AA L++SRR A Sbjct: 42 TRLRREHDPDRVVSLFEAIDDASL-----SASSTRHALSLAARR--LSRSRR--FADAEA 92 Query: 390 SRS*YSGAVSLSGQFAAVIIEELPVVTTFTKKSLVALSQSPEDLPSPHFPVPSDKVVNI 214 S + A Q AAV+ + +K+L A + LPSP P+P + V+++ Sbjct: 93 LLSSHIPASPTEPQLAAVLCSY--AAASLPEKALAAFRSAAPSLPSPISPLPFNAVLSV 149 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,901,116 Number of Sequences: 37544 Number of extensions: 461855 Number of successful extensions: 1199 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1198 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2565528060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -