SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= MFBP03_F_O24
         (905 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-682|AAF45987.2| 1893|Drosophila melanogaster CG2861-PA,...    29   8.8  

>AE014298-682|AAF45987.2| 1893|Drosophila melanogaster CG2861-PA,
            isoform A protein.
          Length = 1893

 Score = 29.1 bits (62), Expect = 8.8
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 6/55 (10%)
 Frame = +1

Query: 76   NSKCIPR--CCYPAALLVCVNAQVSMPPGYAE----KYPITSQFSRSVRHPRDIH 222
            N  C PR    YP   L  +N+Q + PP Y +     YP + QF  S++   DI+
Sbjct: 1688 NDLCYPRGRLNYPVRNLPPMNSQGTYPPNYPQNFLPNYPPSRQFLLSMQRLADIN 1742


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 35,435,844
Number of Sequences: 53049
Number of extensions: 740843
Number of successful extensions: 1920
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1810
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1918
length of database: 24,988,368
effective HSP length: 85
effective length of database: 20,479,203
effective search space used: 4423507848
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -