BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O23 (914 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 40 0.004 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 30 2.3 SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) 29 5.2 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 29 6.9 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.9 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 39.5 bits (88), Expect = 0.004 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +1 Query: 778 PAPXPTPAQGDFSAXXXXXXXXXTPXPXPPXPXXPPXXXXXPPP 909 P P P PA G A P P PP P PP PPP Sbjct: 290 PVPPPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGAPPP 333 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 30.3 bits (65), Expect = 2.3 Identities = 14/45 (31%), Positives = 15/45 (33%) Frame = +1 Query: 778 PAPXPTPAQGDFSAXXXXXXXXXTPXPXPPXPXXPPXXXXXPPPS 912 P P P P P P PP P PP PPP+ Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPPS 912 P P PP P PP PPPS Sbjct: 368 PPPPPPPPPSPPPPPPPPPPS 388 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +1 Query: 778 PAPXPTPAQGDFSAXXXXXXXXXTPXPXPPXPXXPPXXXXXPPP 909 P P P P S +P P P P PP PPP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPP 408 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/45 (33%), Positives = 17/45 (37%) Frame = +1 Query: 778 PAPXPTPAQGDFSAXXXXXXXXXTPXPXPPXPXXPPXXXXXPPPS 912 P+P P P S P P PP P PP PPP+ Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPP-PPPPPPPPPPPPPPPPA 419 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 847 TPXPXPPXPXXPPXXXXXPPP 909 +P P PP P PP PPP Sbjct: 364 SPPPPPPPPPPPPSPPPPPPP 384 >SB_12397| Best HMM Match : Extensin_2 (HMM E-Value=0.14) Length = 659 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 129 HINISRHQILTPPRRNSIGHRHMWGTP 49 H+N Q+L PP R S HR + TP Sbjct: 473 HLNPKHRQLLAPPPRLSPKHRQLLATP 499 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -3 Query: 129 HINISRHQILTPPRRNSIGHRHMWGTP 49 H+N Q+L PP R S HR + TP Sbjct: 625 HLNPKHRQLLAPPPRLSPKHRQLLATP 651 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPPS 912 P P PP P PP PPP+ Sbjct: 475 PPPPPPPPPPPPPFPPPPPPT 495 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPP 483 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPP 484 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPP 485 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPP 486 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPP 487 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 472 PPPPPPPPPPPPPPPPFPPP 491 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 473 PPPPPPPPPPPPPPPFPPPP 492 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 474 PPPPPPPPPPPPPPFPPPPP 493 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 28.7 bits (61), Expect = 6.9 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = -2 Query: 514 PKXIW----WNXGRSRXFLRXIICGIXSXXVXACGFGLLLGXWSMCALALVGGRVC 359 P+ +W W R L ++CG+ + CG GL +C L L G +C Sbjct: 1657 PRSLWPRSLWPRSLWRWSLCLVLCGLGLCCLGLCGLGLC--GLGLCGLGLCGLGLC 1710 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 28.7 bits (61), Expect = 6.9 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPPS 912 P P PP P PP PPP+ Sbjct: 93 PYPPPPYPPYPPPPPYPPPPN 113 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 689 PPPPPPPPPPPPPQPSTPPP 708 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 690 PPPPPPPPPPPPQPSTPPPP 709 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 850 PXPXPPXPXXPPXXXXXPPP 909 P P PP P PP PPP Sbjct: 1157 PPPPPPPPPPPPSSPSPPPP 1176 >SB_19709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 613 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +1 Query: 784 PXPTPAQGDFSAXXXXXXXXXTPXPXPPXPXXPPXXXXXPPP 909 P PTP+Q +P P PP P PPP Sbjct: 561 PAPTPSQTQVKYMGSTSPVATSPPPHPPPPAHHVNKPGVPPP 602 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,359,953 Number of Sequences: 59808 Number of extensions: 386608 Number of successful extensions: 1716 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1125 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -