BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O22 (907 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY051901-1|AAK93325.1| 392|Drosophila melanogaster LD39025p pro... 29 6.6 AE014297-1639|AAF54913.2| 392|Drosophila melanogaster CG8483-PA... 29 6.6 >AY051901-1|AAK93325.1| 392|Drosophila melanogaster LD39025p protein. Length = 392 Score = 29.5 bits (63), Expect = 6.6 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 264 SSPRIQTPNGNGLPNLSNTVHITWNPP-PRPNFISSPNP 377 SSP QT N N N N ++N P P+P +PNP Sbjct: 240 SSPSSQTANNNPPTNNINKSQFSYNQPRPKPVQTINPNP 278 >AE014297-1639|AAF54913.2| 392|Drosophila melanogaster CG8483-PA protein. Length = 392 Score = 29.5 bits (63), Expect = 6.6 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +3 Query: 264 SSPRIQTPNGNGLPNLSNTVHITWNPP-PRPNFISSPNP 377 SSP QT N N N N ++N P P+P +PNP Sbjct: 240 SSPSSQTANNNPPTNNINKSQFSYNQPRPKPVQTINPNP 278 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,531,325 Number of Sequences: 53049 Number of extensions: 701301 Number of successful extensions: 1459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1459 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4423507848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -