BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O20 (850 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccha... 26 5.9 SPAC1071.05 |||S-adenosylmethionine-dependent methyltransferase ... 26 7.8 >SPAC4F8.11 |||WD repeat protein, human WDR24 family|Schizosaccharomyces pombe|chr 1|||Manual Length = 846 Score = 26.2 bits (55), Expect = 5.9 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -2 Query: 621 QQGSSYWRIPQWGSSVSNLKSMS*DSQSFAGSTQGRLP 508 Q+ SS R+ + S++S+LKS SQ+ GST +P Sbjct: 376 QRLSSLNRVASFESNISSLKSALYASQNSDGSTSNPVP 413 >SPAC1071.05 |||S-adenosylmethionine-dependent methyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 339 Score = 25.8 bits (54), Expect = 7.8 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = -1 Query: 625 FSTRLKLLADSTVGKLCFKFKKHVLRFSVFCWKHSGPPSXMNKAIRSP 482 F++RL+ L D K + S+ W+ PPS ++ + +SP Sbjct: 287 FNSRLQKLVDDPNSLKAIKTSTQNVGRSIVYWEKEFPPSNIDSSPQSP 334 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,186,168 Number of Sequences: 5004 Number of extensions: 60354 Number of successful extensions: 169 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 164 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 169 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -