BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O12 (1234 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 27 0.38 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 26 0.67 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 24 2.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 4.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 4.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 4.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 4.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 4.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 4.7 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 4.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 4.7 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 26.6 bits (56), Expect = 0.38 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 341 GGGXGGXXXGXXGEGGG 291 GGG GG G G+GGG Sbjct: 92 GGGRGGGRDGDRGDGGG 108 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 25.8 bits (54), Expect = 0.67 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 110 PXXXPPPPPPPPXPXXPPXPXXXPXRXXPPXXXRPXPPXPPPXPPPPXPP 259 P P P P P PP PP P P PP PP P Sbjct: 149 PKYEPNPSIIDPGPALPPTGFLC--NNYPPLPQVPPLPLPPIFPPTMINP 196 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 23.8 bits (49), Expect = 2.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 122 PPPPPPP 142 PPPPPPP Sbjct: 731 PPPPPPP 737 Score = 23.8 bits (49), Expect = 2.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 125 PPPPPPP 145 PPPPPPP Sbjct: 731 PPPPPPP 737 Score = 23.8 bits (49), Expect = 2.7 Identities = 7/7 (100%), Positives = 7/7 (100%) Frame = +2 Query: 362 PPPPPPP 382 PPPPPPP Sbjct: 731 PPPPPPP 737 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.0 bits (47), Expect = 4.7 Identities = 10/32 (31%), Positives = 10/32 (31%) Frame = +1 Query: 88 PXXXXXXPPXXXPPPPXXPXXPPXPXXXXXPG 183 P PP PP P P P PG Sbjct: 32 PNANSTYPPACYSPPQVAPQYPQHPYAAPAPG 63 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,568 Number of Sequences: 336 Number of extensions: 5010 Number of successful extensions: 37 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 122,585 effective HSP length: 59 effective length of database: 102,761 effective search space used: 36069111 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -