BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O11 (887 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY393190-1|AAS86123.1| 164|Homo sapiens immunoglobulin heavy ch... 33 1.8 AJ276986-1|CAC81830.1| 126|Homo sapiens immunoglobulin heavy ch... 31 7.4 AY358805-1|AAQ89165.1| 544|Homo sapiens brush border protein. 30 9.8 >AY393190-1|AAS86123.1| 164|Homo sapiens immunoglobulin heavy chain protein. Length = 164 Score = 32.7 bits (71), Expect = 1.8 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = -1 Query: 413 LNTNFIQWSSLDFINQGKYCSELVVRGSSW 324 +NT +++WSSL + KY + + GSSW Sbjct: 87 INTAYLEWSSLKASDSAKYYCSIGLHGSSW 116 >AJ276986-1|CAC81830.1| 126|Homo sapiens immunoglobulin heavy chain variable region protein. Length = 126 Score = 30.7 bits (66), Expect = 7.4 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = -1 Query: 413 LNTNFIQWSSLDFINQG-KYCSELVVRGSSW 324 +NT ++QWSSL + YC+ V RG SW Sbjct: 57 INTVYLQWSSLKASDTAIYYCARHVSRGRSW 87 >AY358805-1|AAQ89165.1| 544|Homo sapiens brush border protein. Length = 544 Score = 30.3 bits (65), Expect = 9.8 Identities = 21/47 (44%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -1 Query: 491 VFYIKQFVNAS*PDPTEQTHSICNLYLNTNFIQWSSLDFINQ-GKYC 354 V + QFVN T Q HS C L LNTN LD +Q G YC Sbjct: 202 VIFTGQFVNG-----TSQVHSECGLILNTNAELCQYLDNRDQEGFYC 243 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,841,598 Number of Sequences: 237096 Number of extensions: 1659876 Number of successful extensions: 3973 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3959 length of database: 76,859,062 effective HSP length: 90 effective length of database: 55,520,422 effective search space used: 11381686510 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -