BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O11 (887 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81581-2|CAD56595.1| 672|Caenorhabditis elegans Hypothetical pr... 29 5.9 Z81581-1|CAD56594.1| 655|Caenorhabditis elegans Hypothetical pr... 29 5.9 Z81542-6|CAE17834.1| 365|Caenorhabditis elegans Hypothetical pr... 28 7.8 >Z81581-2|CAD56595.1| 672|Caenorhabditis elegans Hypothetical protein F08A10.1c protein. Length = 672 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 325 GHVSLRAVMGTGVLGLAGRDGGSCAYRRHRRTRADD 218 GH+ L A GT V +G GGSCA R +D Sbjct: 88 GHIQLTA-NGTPVFAYSGGGGGSCAVSPSSSARRED 122 >Z81581-1|CAD56594.1| 655|Caenorhabditis elegans Hypothetical protein F08A10.1b protein. Length = 655 Score = 28.7 bits (61), Expect = 5.9 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = -2 Query: 325 GHVSLRAVMGTGVLGLAGRDGGSCAYRRHRRTRADD 218 GH+ L A GT V +G GGSCA R +D Sbjct: 88 GHIQLTA-NGTPVFAYSGGGGGSCAVSPSSSARRED 122 >Z81542-6|CAE17834.1| 365|Caenorhabditis elegans Hypothetical protein F49A5.9 protein. Length = 365 Score = 28.3 bits (60), Expect = 7.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -1 Query: 404 NFIQWSSLDFINQGKYCSELVVRGSSWSRQSASCDG 297 +F+ SS+D+ G C + W ++S S DG Sbjct: 154 DFVSNSSVDYFWTGLICKGNTISSCIWDKESGSADG 189 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,839,212 Number of Sequences: 27780 Number of extensions: 272293 Number of successful extensions: 744 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 726 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2244863852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -