BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O10 (897 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 45 9e-05 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 43 4e-04 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 41 0.002 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 40 0.002 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 38 0.008 08_01_0059 - 394001-394708 38 0.008 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 38 0.011 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 38 0.014 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 37 0.019 01_01_0070 - 542603-542686,542803-543441 37 0.019 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 37 0.025 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 37 0.025 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 37 0.025 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 36 0.033 12_02_1174 - 26696869-26698191 36 0.044 07_01_0479 + 3606663-3607448 36 0.044 03_01_0515 - 3864796-3865425 36 0.044 09_03_0145 - 12749288-12751510 36 0.058 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 36 0.058 09_02_0369 - 8012470-8013120 35 0.076 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 35 0.076 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 35 0.10 04_01_0034 - 401208-402923 35 0.10 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 35 0.10 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 34 0.13 03_02_0342 - 7645323-7645909,7646323-7646491 34 0.13 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 34 0.18 03_06_0599 + 34984869-34985319,34986581-34987563 33 0.23 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 33 0.23 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 33 0.31 07_01_0862 - 7172083-7172931 33 0.31 02_03_0279 + 17250347-17252098 33 0.31 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 33 0.31 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 33 0.31 12_02_0299 - 17051570-17052474,17053542-17053755 33 0.41 08_02_1256 + 25645085-25645396 33 0.41 06_03_1153 - 28047125-28047751 32 0.54 06_01_0486 - 3455030-3455770 32 0.54 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 32 0.71 07_03_1710 - 28903614-28903673,28904982-28905146,28905453-289056... 32 0.71 03_02_0738 - 10824121-10825572 32 0.71 03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828,997... 32 0.71 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 32 0.71 01_01_0082 + 625198-625719 32 0.71 11_06_0610 - 25449085-25453284 31 0.94 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 31 0.94 07_01_0080 + 587674-588510 31 0.94 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 31 0.94 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 31 0.94 09_02_0543 + 10427321-10428315,10428440-10429154 31 1.2 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 31 1.2 04_04_0675 + 27183826-27184443 31 1.2 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 31 1.2 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 31 1.2 08_02_0193 - 14073103-14073246,14073332-14073481,14073571-140736... 31 1.6 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 31 1.6 04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064,654... 31 1.6 02_04_0056 + 19313422-19313967,19314035-19314168,19314263-193143... 31 1.6 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 31 1.6 12_01_0495 - 3935395-3937110 30 2.2 11_01_0133 + 1121392-1122731,1123417-1123858 30 2.2 11_01_0066 - 536281-537196,537397-537452 30 2.2 10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526,595... 30 2.2 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 30 2.2 12_01_0877 - 8415186-8415272,8415696-8416310 30 2.9 05_01_0380 + 2978256-2979284 30 2.9 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 30 2.9 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 30 2.9 03_06_0297 - 32924162-32924605 30 2.9 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 30 2.9 03_05_0576 + 25765137-25766420 30 2.9 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 30 2.9 01_06_1377 + 36764461-36765339 30 2.9 01_05_0490 + 22672241-22674679 30 2.9 01_02_0031 + 10364487-10365407 30 2.9 12_02_0756 + 22839673-22839870,22839961-22842194,22842280-228425... 29 3.8 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 3.8 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 3.8 08_02_1084 - 24232968-24234779 29 3.8 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 29 3.8 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 29 3.8 07_03_0906 + 22481456-22481802,22482105-22482186,22482299-224824... 29 3.8 07_01_0516 - 3850252-3852870 29 3.8 05_03_0039 - 7621613-7622695 29 3.8 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 3.8 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 29 3.8 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 29 3.8 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 29 5.0 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 29 5.0 09_04_0324 - 16686872-16687074,16687479-16687521,16687735-166880... 29 5.0 07_03_1433 + 26513728-26514135,26525534-26526280 29 5.0 07_03_1432 - 26508135-26508881,26509301-26509708 29 5.0 07_03_1382 - 26170563-26170631,26171151-26171843 29 5.0 06_03_0696 + 23617687-23617851,23618838-23619536 29 5.0 05_03_0040 - 7646525-7647775 29 5.0 03_05_0388 + 23726957-23727418,23730016-23730262,23731072-237312... 29 5.0 02_05_1277 - 35408097-35409080 29 5.0 02_03_0120 + 15463163-15465250 29 5.0 01_05_0534 + 22999876-23000333,23000835-23000949 29 5.0 01_05_0225 - 19501643-19501903,19503974-19504477 29 5.0 01_03_0117 + 12684729-12685886,12685978-12686145,12686292-126863... 29 5.0 12_02_0193 + 15242068-15242265,15242356-15244589,15244675-152449... 29 6.6 12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351,919... 29 6.6 11_06_0069 + 19770182-19770379,19770470-19772703,19772789-197730... 29 6.6 11_04_0270 - 15590955-15591146,15591421-15591502,15591592-155917... 29 6.6 11_04_0158 + 14207463-14207629,14207724-14207774,14207874-142080... 29 6.6 10_07_0154 + 13487971-13488168,13488259-13488483,13488592-134904... 29 6.6 10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509,138... 29 6.6 09_04_0487 - 18014469-18014660,18014935-18015016,18015297-180155... 29 6.6 09_02_0601 + 11112201-11112386,11112471-11114080,11114345-111145... 29 6.6 09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962,763... 29 6.6 09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375,469... 29 6.6 08_02_1615 + 28257275-28258428,28258523-28259144 29 6.6 08_02_0758 + 20848078-20849579,20849660-20849850,20849944-208501... 29 6.6 08_02_0450 - 17266977-17267165,17268017-17268053,17268139-172695... 29 6.6 08_02_0194 + 14084828-14085025,14085116-14085788,14085855-140870... 29 6.6 08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943,387... 29 6.6 07_03_1713 + 28939446-28939574,28939674-28940231,28940338-289404... 29 6.6 07_03_0890 - 22332768-22333382 29 6.6 06_03_1445 - 30209354-30209396,30209798-30209875,30210220-302102... 29 6.6 06_03_1433 - 30129184-30129226,30129628-30129705,30130050-301301... 29 6.6 06_03_1416 + 30027066-30027663,30027739-30027848,30027927-300280... 29 6.6 06_03_0750 - 24140988-24141037,24141108-24141345,24142158-241422... 29 6.6 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 29 6.6 06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469,978... 29 6.6 05_06_0026 - 25024807-25025300,25025432-25025495,25025567-250256... 29 6.6 05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792,516... 29 6.6 05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305,506... 29 6.6 05_01_0142 - 940421-940701,941262-941574 29 6.6 04_03_0709 + 18902507-18902704,18902795-18905028,18905114-189053... 29 6.6 04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527,479... 29 6.6 02_04_0021 + 18975992-18976408 29 6.6 02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089,527... 29 6.6 02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551,270... 29 6.6 01_06_1321 + 36280691-36281269 29 6.6 01_06_0075 - 26201231-26201422,26201697-26201778,26201868-262019... 29 6.6 01_05_0224 + 19485296-19485493,19485584-19487817,19487903-194881... 29 6.6 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 6.6 12_01_0135 + 1042889-1044255,1045368-1045809 28 8.8 11_08_0048 - 28022335-28022520,28022607-28022699,28022804-280228... 28 8.8 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 28 8.8 11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665,794... 28 8.8 08_02_1553 + 27835320-27835364,27836853-27836966,27837062-278374... 28 8.8 08_02_0839 + 21693348-21694853 28 8.8 06_03_1172 - 28147957-28148274,28149362-28149877 28 8.8 06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-38... 28 8.8 05_07_0031 - 27183252-27183317,27183542-27184282 28 8.8 05_03_0458 + 14280953-14281866,14281964-14282912 28 8.8 04_03_0925 - 20856628-20856690,20856786-20856845,20856924-208570... 28 8.8 04_03_0904 + 20717005-20718087 28 8.8 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 28 8.8 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 28 8.8 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 28 8.8 02_04_0654 - 24755339-24755408,24755488-24755624,24756243-247563... 28 8.8 02_02_0663 - 12740733-12741104,12741260-12741326,12741709-127418... 28 8.8 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/44 (47%), Positives = 21/44 (47%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P K P PPP P PPP PPG KK PPP P G Sbjct: 343 GPPPPPPAKGPPPPPPPKGPSPPPPP--PPGGKKGGPPPPPPKG 384 Score = 42.3 bits (95), Expect = 5e-04 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKK--XXPPPXPPGXK 890 P K P PPP+ PP PP PP K PPP PPG K Sbjct: 329 PPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGK 373 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ P PPP PP K PPP PP Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 35.9 bits (79), Expect = 0.044 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 A P P P PP PPP PP K PPP P Sbjct: 309 ASPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPP 349 Score = 33.5 bits (73), Expect = 0.23 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP K PPP PP Sbjct: 311 PAPPPP--PPPKPAAAAPPPPPPPKAAPPPPPP 341 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEX-----PPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ PP PP PP K PPP PP Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPK--GPPPPPP 349 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P K P PPP PP PP K PP PG Sbjct: 352 GPPPPPPPKGPSPPPPP-PPGGKKGGPPPPPPKGGASRPPAAPG 394 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 42.7 bits (96), Expect = 4e-04 Identities = 20/42 (47%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXK--KKXXPPPXPP 881 PK P PPP PP PPP PP KK PPP PP Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP PP + PPP G Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPPIKKG 383 Score = 31.9 bits (69), Expect = 0.71 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP PPP PP PPP PP K Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPPPIK 381 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/31 (54%), Positives = 17/31 (54%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP PPG PPP PPG Sbjct: 920 PPPPRPPGAPPPP-PPPGKPGGPPPPPPPPG 949 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 3/26 (11%) Frame = +3 Query: 777 KXPGXPPPEXP---PXXPPPXFXPPG 845 + PG PPP P P PPP PPG Sbjct: 924 RPPGAPPPPPPPGKPGGPPPPPPPPG 949 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P Q P PPP PP PPP PP PPP PP Sbjct: 342 PVQPSNAPPPPPPPPPPPPPPP---PPKLNTAPKPPPPPP 378 Score = 35.5 bits (78), Expect = 0.058 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPP 881 P P PP PP PPP PP K PPP PP Sbjct: 338 PSPRPVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 34.3 bits (75), Expect = 0.13 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PPP K PPP P Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP P K PPP PP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAP---KPPPPPPPPP 381 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G+ P + P P P PPP PP PPP PP Sbjct: 327 GSTPDTKQVTSPSPRPVQPSNAPPPPPPPP----PPPPPPPPP 365 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 38.3 bits (85), Expect = 0.008 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P P PPP PP PPP PP + + PPP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPP 142 Score = 35.9 bits (79), Expect = 0.044 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXP-----PGXKKKXXPPPXP 878 G P Q P PP PP PPP P PG ++ PPP P Sbjct: 39 GHMPPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPP 86 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P P PP PP PPP PP + PPP Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 6/46 (13%) Frame = +3 Query: 762 PKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P+ + P PPP + PP PPP PP PPP P Sbjct: 86 PQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQP 131 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P Q ++ P PPP+ PPP P G PPP PP Sbjct: 73 GPGPPQQQQPP--PPPQMYYQPPPPP-PPYGVNSSQPPPPPPP 112 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PPP P PPP PP + + P PP Sbjct: 46 GAPPPFLAPPPPPPPGPPPPHQPQFNFGPGPP 77 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXP-----PXXPPPXFXPPGXKKKXXPPPXPP 881 PG PPP P P P PP + PPP PP Sbjct: 60 PGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPP 97 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Frame = +3 Query: 750 GGAXPKQXKKXP-GXPPPEXPPXX--------PPPXFXPPGXKKKXXPPPXPP 881 GG P+ P G PPP+ P PPP PP PPP P Sbjct: 16 GGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPPHQP 68 >08_01_0059 - 394001-394708 Length = 235 Score = 38.3 bits (85), Expect = 0.008 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP ++ PPP PP Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPP 31 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P ++ P PPP PP PPP PP PPP P Sbjct: 4 PPPPRRAP--PPPATPP--PPPRRAPPPPSPPIRPPPPP 38 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP PPP PP Sbjct: 46 PPPSHPLAPPPPHISPPA---PVPPPPSPP 72 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP + PPP P Sbjct: 25 PPPPSPPIRPPP---PPTPRPYAPPPPSHP 51 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/42 (33%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +3 Query: 762 PKQXKKXPGXPPP---EXPPXXPPPXFXPPGXKKKXXPPPXP 878 P++ P PPP PP PP PP + PP P Sbjct: 7 PRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 48 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/37 (32%), Positives = 14/37 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P + P PP PP P + PP PPP Sbjct: 20 PPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPP 56 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 37.9 bits (84), Expect = 0.011 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +3 Query: 762 PKQXKKXPGXPPPEX----PPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P K P PPP+ PP PPP PG K PPP PG K Sbjct: 592 PPAPKAAPPPPPPKSTGPGPPRPPPPAM--PGSSKTRPPPPLKPGAK 636 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPP 881 P K PPPE P P PP K P PP PP Sbjct: 575 PMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPP 615 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPP-PEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PP P+ P PPP PG + PPP PG Sbjct: 589 PSPPPAPKAAPPPPPPKSTGPGPPR--PPPPAMPG 621 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 37.5 bits (83), Expect = 0.014 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 G KQ P PPP PP PPP K PPP P Sbjct: 313 GAEMNKQMASPPSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPP 355 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/30 (53%), Positives = 16/30 (53%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP K PPP PP Sbjct: 615 PPPPRPPGAPPP---PPPPGKPGGPPPPPP 641 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 3/33 (9%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXP---PXXPPPXFXPPG 845 A P + PG PPP P P PPP PG Sbjct: 612 ALPPPPPRPPGAPPPPPPPGKPGGPPPPPPRPG 644 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-PXXPPPXFXPPGXKKKXXPPPXPP 881 PK+ P PPP P P PPP PP PP PP Sbjct: 87 PKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPP 127 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P KK P PP PP PPP PP PPP P Sbjct: 84 PPTPKKAP-PPPVTPPPVTPPPVTPPPVSPPPATPPPALP 122 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 A P P PPP PP PP PP PPP Sbjct: 90 APPPPVTPPPVTPPPVTPPPVSPPPATPPPALPPSTPPP 128 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PPP P P PP Sbjct: 107 PPPVSPPPATPPPALPPSTPPPVAAPAEAPAALPPATTPP 146 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPG-XKKKXXPPPXPP 881 A P P PPP P PPP PP PPP P Sbjct: 70 APPVAPAVAPVTPPPPTPKKAPPPPVTPPPVTPPPVTPPPVSP 112 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP PP P PP Sbjct: 102 PPPVTPPPVSPPPATPPPALPPSTPPPVAAPAEAPAALPP 141 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP PP P P Sbjct: 97 PPPVTPPPVTPPPVSPPPATPPPALPPSTPPPVAAPAEAP 136 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 36.7 bits (81), Expect = 0.025 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP--XPPG 884 A P + PG PPP P PPP F P + PPP PPG Sbjct: 61 APPPGARPFPGSPPP---PSQPPPPFARPAAPVQQQPPPFGGPPG 102 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP PP PP F PG + PPP PPG Sbjct: 380 PRFPPPPPPPDTRPP-FMAPGVNARPLPPP-PPG 411 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PG + PPP PP Sbjct: 251 PPPPPPPPGPPPREIVPG--QTLLPPPPPP 278 Score = 32.3 bits (70), Expect = 0.54 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP PP P PG PPP PPG Sbjct: 227 PPLPPPPPPPPKPANIAGAPGL-PLPPPPPPPPG 259 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPP 842 G P Q + P PP PP PPP + P Sbjct: 411 GLPPAQMQMAPFGVPPGPPPMLPPPFYPGP 440 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 36.7 bits (81), Expect = 0.025 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 2/35 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP--PGXKKKXXPPPXPP 881 P PPP P PPP P P K++ PPP PP Sbjct: 56 PPPPPPPQPAKEPPPPTKPKHPKPKQQQHPPPPPP 90 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 36.3 bits (80), Expect = 0.033 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P K P PP PPP P G K PPP PP Sbjct: 529 PSDRKLPSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 35.1 bits (77), Expect = 0.076 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PP PPP PPP PP Sbjct: 552 PPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPP 591 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP P F PP PPP P Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLP 576 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PPP PP P PG PPP PP Sbjct: 688 GPPPPPPPPLPPANRTNGPGVPSAPPPPPPPP 719 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PP PPP P PPP PP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPP 572 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXX----PPPXFXPPGXKKKXXPPPXPPG 884 P + P PPP P PPP PP + PPP PG Sbjct: 613 PNRSVPPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPG 657 Score = 31.5 bits (68), Expect = 0.94 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPP-----GXKKKXXPPPXPP 881 P PPP PP P PP G K PPP PP Sbjct: 634 PPPPPPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPP 671 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PP PPP P + PPP PP Sbjct: 588 PPPPPPLPNCLVPSPPPPPPPPPILP---NRSVPPPPPPP 624 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPP-----EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PP PPP PP Sbjct: 605 PPPPPPILPNRSVPPPPPPP---PPLPNHSVLPPPPPP 639 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 KK P PPP PP PP P PP K Sbjct: 759 KKAPAPPPPPPQAPKPPGTVPPPPPLHGASGRPHPPSSK 797 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 9/39 (23%) Frame = +3 Query: 792 PPPEXP---------PXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P P PPP PP + PPP PP Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPP 623 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PG P PP PPP G P P P Sbjct: 699 PANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPPLPPP 737 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 N P P PP PPP KK PPP PP Sbjct: 725 NGPSAPAPPLPPPLPAAANKRNPPAPPPPPLMT--GKKAPAPPPPPP 769 >12_02_1174 - 26696869-26698191 Length = 440 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + + P PPP PP PPP P P P PP Sbjct: 143 PVKPQPPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPP 182 Score = 35.5 bits (78), Expect = 0.058 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P PPP P PPP PP PPP PP K Sbjct: 138 PHRPPPVKPQ--PPPSLPPPPPPPPPPPPPRPPSVK 171 Score = 35.5 bits (78), Expect = 0.058 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P PPP PP PP PP + K PPP Sbjct: 154 PPPPPPPPPPPPRPPSVKPPVVQPKPQPPP 183 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP P PPP PP Sbjct: 183 PSLQPPSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPP 222 Score = 33.1 bits (72), Expect = 0.31 Identities = 16/42 (38%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP--PXFXPPGXKKKXXPPPXPP 881 P+ P PP PP PP P P + K PPP PP Sbjct: 210 PQPPPTLPPPSPPPPPPTVPPRTPGDTPAVVEPKPQPPPPPP 251 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKKKXXPPPXPP 881 P P PPP P PP P PP + PPP PP Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPPPP 195 Score = 32.3 bits (70), Expect = 0.54 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 5/45 (11%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXP-----PPXFXPPGXKKKXXPPPXPP 881 P+ + P PPP P P P PP K PPP PP Sbjct: 258 PRVLEPKPSPPPPSPLPPPPEDYWSPTAVTPPEPTKPKPPPPSPP 302 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEX-----PPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP P PPP PP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPP 161 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP P PPP PP + + PP PP K Sbjct: 116 PPALSPVPPPPP--PPRTRTRVEPPHRPPPVK 145 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPP-XXPPPXFXPPGXKKK-XXPPPXPP 881 P + P PP PP PPP PP K P P PP Sbjct: 172 PPVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPPVVQPKPQPP 213 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P PP PP P PP PPP P Sbjct: 188 PSPPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPPPPPP 226 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + P PP P PP PP PPP PP Sbjct: 192 PPPPTRPPSVKPPVVQPKPQPPPTLPP-----PSPPPPPP 226 >07_01_0479 + 3606663-3607448 Length = 261 Score = 35.9 bits (79), Expect = 0.044 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +3 Query: 756 AXPKQXKKXPGX-PPPEXPPXXPPPXFXPPGXKKK-XXPPPXPPG 884 A P+ + PG PPP PP P P PPG PP PPG Sbjct: 162 AYPQVVRPPPGQMPPPMRPPQMPIPFQRPPGVPPAFPGGPPPPPG 206 Score = 33.5 bits (73), Expect = 0.23 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P+ PG PPP P PPP F P PP PPG Sbjct: 218 PQVRPGMPGGPPPGMRPGMPPPPFRP-------GMPPPPPG 251 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PG PPP P PPP PPG ++ PP Sbjct: 234 PGMPPPPFRPGMPPP---PPGPQQPGQNPP 260 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/40 (40%), Positives = 19/40 (47%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P ++ PG PP P PPP PPG + PP PP Sbjct: 184 PIPFQRPPGVPPAF--PGGPPP---PPGPFMRGPPPMGPP 218 Score = 29.1 bits (62), Expect = 5.0 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 13/47 (27%) Frame = +3 Query: 783 PGXPPPE-------XPPXXPP------PXFXPPGXKKKXXPPPXPPG 884 PG PPP PP PP P PPG + PPP PG Sbjct: 198 PGGPPPPPGPFMRGPPPMGPPQVRPGMPGGPPPGMRPGMPPPPFRPG 244 >03_01_0515 - 3864796-3865425 Length = 209 Score = 35.9 bits (79), Expect = 0.044 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PPP PP PPP PP Sbjct: 72 PPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 35.1 bits (77), Expect = 0.076 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P PPP P PPP PP K PPP Sbjct: 90 PPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 34.3 bits (75), Expect = 0.13 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 783 PGXPPPEXPP---XXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PPP PP K PPP P Sbjct: 86 PPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP PPP PP Sbjct: 62 PPPAAGPLMPPPP-PPPSVTSSPPPPPLPP 90 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP PPP PP Sbjct: 84 PPPPLPPPPPPPAASPP------PPPPSPP 107 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEX--PPXXPPPXFX----PPGXKKKXXPPPXPP 881 A + + P PP E PP PPP PP PPP PP Sbjct: 30 APSPEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPP 77 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PPP PP PP PP Sbjct: 91 PPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 2/44 (4%) Frame = +3 Query: 756 AXPKQXKKXPGXPP--PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P P P P PP PPP PPP PP Sbjct: 52 APPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPP 95 >09_03_0145 - 12749288-12751510 Length = 740 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP PP PP PG PPP P G Sbjct: 28 PSPPPPPPPPGIQPPPPALPGMPHGRPPPPFPGG 61 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P P PPP PPG + PPP PG Sbjct: 18 KPPFKPKPTNPSPPPPPP--PPGIQP---PPPALPG 48 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 35.5 bits (78), Expect = 0.058 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP PPP PP Sbjct: 426 PPPPLPPPPPPPP-PPPPPLPPNMPPPLPP 454 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PPP PP PPP P Sbjct: 428 PPLPPPP-PPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P PPP PP PPP PP + P Sbjct: 437 PPPPPPPLPPNMPPPLPPPPEPELNGAP 464 >09_02_0369 - 8012470-8013120 Length = 216 Score = 35.1 bits (77), Expect = 0.076 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P+Q PPP+ PP PPP F P + PP P Sbjct: 54 PQQQFITAQPPPPDEPPLKPPPSFYPAVLPPEPPPPRRP 92 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 35.1 bits (77), Expect = 0.076 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PP K PP PP Sbjct: 1923 PKQPPPHAPPPPPPP---PPVEGKPKPPPHAPP 1952 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 K+ P PP PP PPP P PPP P K Sbjct: 1924 KQPPPHAPPPPPP--PPPVEGKPKPPPHAPPPPPPEAKK 1960 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P++ + P PPP P PPP P PPP P Sbjct: 82 PRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAP 120 >04_01_0034 - 401208-402923 Length = 571 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKK 857 P+Q + P PPP PP PPP P K K Sbjct: 312 PQQQRAKPSRPPPPPPPLDPPPRAAAPPAKCK 343 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXP---PPXFXPPGXKKKXXPPPXPP 881 P Q P PP PP P PP PP PPP PP Sbjct: 269 PPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGTQPPPPPPP 311 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP+ PP P PP PP PP Sbjct: 255 GTLPNGSGGPPRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPP 297 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P G PP PP PPP PP PPP PP Sbjct: 252 AAPGTLPNGSGGPPRPPPPQVPPP---PP-----QAPPPPPP 285 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 G P + PPP P PPP P G + PPP Sbjct: 260 GSGGPPRPPPPQVPPPPPQAPPPPPPN-APMGMPPRIPPPP 299 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 34.3 bits (75), Expect = 0.13 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +3 Query: 753 GAXPKQXKKXPGXPP--PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PP P PP PPP PP PPP PP Sbjct: 1145 GPPPLPSDSPPCQPPLPPSPPPATPPP---PPPLSPSLPPPPPPP 1186 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP P PPP PP + P P PP Sbjct: 1173 PPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 31.5 bits (68), Expect = 0.94 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP--PXXPPPXFXPP---GXKKKXXPPPXP 878 P P PPP P P PPP PP G + PPP P Sbjct: 1159 PLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLP 1202 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PP P PPP P PPP P G Sbjct: 1158 PPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSG 1191 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPP--XXPPPXFXPPGXKKKXXPPPXPP 881 P+ P PP PP PPP PP PP PP Sbjct: 1143 PEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPP 1184 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 5/45 (11%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXP-----PPXFXPPGXKKKXXPPPXPP 881 P Q P PP PP P PP PP P P PP Sbjct: 1155 PCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPP 1199 >03_02_0342 - 7645323-7645909,7646323-7646491 Length = 251 Score = 34.3 bits (75), Expect = 0.13 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 K KK PPP PP P P + PP P P P Sbjct: 164 KYKKKFMFAPPPPPPPRPPAPEYKPPTPTLTPIPTPEP 201 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP P PP PPP PP Sbjct: 71 PPPPRPPSFAPENALPPSSPPPPSPPPPPP 100 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEX-PPXXPPPXFXPPGXKKKXXPPPXPP 881 G+ P + P P PP PPP PP PPP PP Sbjct: 67 GSLPPPPPRPPSFAPENALPPSSPPPPSPPPPPPSS--PPPVPP 108 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 33.5 bits (73), Expect = 0.23 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PPP PP ++ P P P Sbjct: 396 PAPPPPPQPPPPPPP---PPHQRETPSPSPPP 424 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP PPP PP +++ P PP Sbjct: 395 GPAPP--PPPQPPPPPPPPPHQRETPSPSPPP 424 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 33.5 bits (73), Expect = 0.23 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPP---PXPPGXK 890 P PPP PP PPP P PP P PPG + Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPPGYR 157 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXP-PPXFXPPGXKKKXXPPP 872 P+ P PP + PP P PP PP + PPP Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP PP PP PP Sbjct: 116 PPRPPPPPPPH--PPEDPPPHPPHPPDHPPPPP 146 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 + P PPP P PP PP PPP PP Sbjct: 118 RPPPPPPPHPPEDPPPHPPHPP-----DHPPPPPP 147 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 33.1 bits (72), Expect = 0.31 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P Q + P PPP PP PP + PPP P Sbjct: 256 APPPQSVRPPPPPPPPPPPPPMPPRTDNASTQAAPAPPPPLP 297 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPP 881 GA K+ PP PP PPP PP + P P PP Sbjct: 250 GAEDKRAPPPQSVRPPPPPPPPPPPPPMPPRTDNASTQAAPAPPPP 295 >07_01_0862 - 7172083-7172931 Length = 282 Score = 33.1 bits (72), Expect = 0.31 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 9/48 (18%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXP---------PPXFXPPGXKKKXXPPPXP 878 P KK P PPP PP P PP PP KKK PPP P Sbjct: 175 PLPPKKKP-LPPPSPPPQPPLPEKENTPLPPLLLPP--KKKPLPPPSP 219 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/30 (53%), Positives = 17/30 (56%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP + P PPP PP KKK PPP PP Sbjct: 164 PPRKKPLLYPPPL--PP--KKKPLPPPSPP 189 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 798 PEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P PP PPP K PPP PP K Sbjct: 125 PAPPPPPPPPPPTAEEKKLLLFPPPLPPRKK 155 >02_03_0279 + 17250347-17252098 Length = 583 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP F P P P G Sbjct: 125 PPPPPPPPPPPPLFAKPDLDSTAPPQPKEEG 155 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PK PG P P+ P P P PP K P P PG K Sbjct: 176 PKPKPPKPG-PKPKPPKPGPKPKPKPPKPGPKPKPKPPKPGPK 217 Score = 31.9 bits (69), Expect = 0.71 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P K PG P P+ P P P PG K K P P PG K Sbjct: 167 PSPPKPKPG-PKPKPPKPGPKPKPPKPGPKPK--PKPPKPGPK 206 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P + K P PP+ P PP PG K K PP P K Sbjct: 169 PPKPKPGPKPKPPKPGPKPKPP---KPGPKPKPKPPKPGPKPK 208 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PK K P P P P P P P K P P PP Sbjct: 160 GPKPKP-KPSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPP 201 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PK K P P P P P PG K K P P K Sbjct: 157 PKPGPKPKPKPSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPK 199 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P PPP PP PPP PP PP Sbjct: 74 PSPPPPPPPPPPPPPVPVPPAYSVTSSVPP 103 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PPP F P PP P Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFPPLAPLFPPYP 349 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P P PPP P PP F PP PPP PP Sbjct: 259 AFPFPLPPWPWAPPPAFPFPHLPPIFSPPS-----PPPPPPP 295 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXP---PXXPP-PXFXP-PGXKKKXXPPPXPP 881 P PPP P P PP P F P P PPP PP Sbjct: 290 PPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPPPPPP 327 >08_02_1256 + 25645085-25645396 Length = 103 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PPP PP PP PP +++ PPP Sbjct: 63 PPPPPPPLPSPPPPPPPQQQEEQSPPP 89 >06_03_1153 - 28047125-28047751 Length = 208 Score = 32.3 bits (70), Expect = 0.54 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PP PPP F P PP P Sbjct: 17 PPPLSPPPPPPPIFYSPPDVSYFSPPALP 45 >06_01_0486 - 3455030-3455770 Length = 246 Score = 32.3 bits (70), Expect = 0.54 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PP PP PP PPP PP Sbjct: 78 PYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPP 110 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PP PPP PP PPP PP Sbjct: 113 PPYIPPPTPPYVPPP--TPPS-PPPYVPPPTPP 142 Score = 29.5 bits (63), Expect = 3.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 8/44 (18%) Frame = +3 Query: 783 PGXPPPEXP------PXXPPPXFXPPGXKK--KXXPPPXPPGXK 890 P PPP P P PPP PP PPP PP K Sbjct: 114 PYIPPPTPPYVPPPTPPSPPPYVPPPTPPSPPPYVPPPSPPATK 157 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 3/43 (6%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKKKXXPPPXPP 881 P P PP PP PP P PP PPP PP Sbjct: 90 PPYVPSPPPYVPPYIPPPTPPYVPPYIPPP--TPPYVPPPTPP 130 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 31.9 bits (69), Expect = 0.71 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXP 839 A P + P PPP PP PPP P Sbjct: 71 AAPPPPQTPPSPPPPPPPPPPPPPPLSP 98 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PPP+ PP PPP PP P P Sbjct: 74 PPPQTPPSPPPPPPPPPPPPPPLSPTP 100 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP PPP PP Sbjct: 73 PPPPQTPPSPPPPPPPP-------PPPPPP 95 >07_03_1710 - 28903614-28903673,28904982-28905146,28905453-28905638, 28905784-28905927,28906281-28906460,28906559-28907215 Length = 463 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ P PPP PP PP PP Sbjct: 53 PTAPPPKPSP-TPPPASPPPAPTPPQTRPPSPP 84 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPP 869 P P P PP PPP PP + PP Sbjct: 57 PPKPSPTPPPASPPPAPTPPQTRPPSPPP 85 >03_02_0738 - 10824121-10825572 Length = 483 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 792 PPPEXPPXXPPP-XFXPPGXKKKXXPPPXPP 881 PPP P PPP F PP PPP P Sbjct: 79 PPPSPPSSSPPPLSFPPPPPPPSSPPPPALP 109 >03_02_0631 + 9969841-9969868,9969965-9970082,9970186-9970828, 9971146-9971935,9972002-9972051,9972618-9972704 Length = 571 Score = 31.9 bits (69), Expect = 0.71 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P +K P PP PP P PP K PP PP K Sbjct: 69 PPPLQKAPKVSPP--PPQKPDKVSPPPAQKPSKVSPPPPPPQK 109 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 31.9 bits (69), Expect = 0.71 Identities = 17/43 (39%), Positives = 20/43 (46%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G +Q +K P PPP PP PP F + PPP PP Sbjct: 954 GGSAQQSEKRP--PPPPPPPNVAPPPFT---RQDIPPPPPSPP 991 >01_01_0082 + 625198-625719 Length = 173 Score = 31.9 bits (69), Expect = 0.71 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PP PP PPP PP PP P G Sbjct: 66 PPPPPVYYPPPSPPPVAYPPPTTPSTNCPPPPYG 99 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPPE P P P PP K PPP P Sbjct: 1146 PPPEKSPPPPAPVILPP-PPIKSPPPPAP 1173 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPP-XFXPPGXKKKXXPPPXPPG 884 A P Q + PP P PPP PP PPP P G Sbjct: 528 APPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHSPPPVPEG 571 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP P PP P +K PPP P Sbjct: 1129 PPPTVKPLPPPVPVSSPPPPEKSPPPPAP 1157 Score = 29.5 bits (63), Expect = 3.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P P P PP +K PPP P Sbjct: 1226 PPPVKSPPPPAPVISPPPPEKS--PPPAAP 1253 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP P P P PP K PPP P Sbjct: 1178 PPPVKSPPPPAPVILPP-PPVKSPPPPAP 1205 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP P P P PP K PPP P Sbjct: 1194 PPPVKSPPPPAPVISPP-PPVKSPPPPAP 1221 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP P P P PP K PPP P Sbjct: 1210 PPPVKSPPPPAPVILPP-PPVKSPPPPAP 1237 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PP + K PPP P Sbjct: 569 PEGHTPSPPKSGPPAGESPPTPESKASPPPTP 600 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP P P P PP K PPP P Sbjct: 1162 PPPIKSPPPPAPVISPP-PPVKSPPPPAP 1189 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP P PP P K PPP P Sbjct: 1305 PPPAVKPLPPPAPVSLPPPAVKPLPPPVP 1333 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 783 PGXP--PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG P PPE PP P P PP PP P Sbjct: 419 PGKPSEPPEKPPLIPVP-VGPPEKSPAYEEPPAAP 452 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 31.5 bits (68), Expect = 0.94 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPP--PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + + P PP P PP P P P + PPP PP Sbjct: 20 PPELRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPP 61 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 5/35 (14%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKK-----KXXPPPXPP 881 PPP PP PP PP + PPP PP Sbjct: 28 PPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPP 62 >07_01_0080 + 587674-588510 Length = 278 Score = 31.5 bits (68), Expect = 0.94 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 ++ P PPP PPP PP PPP PP Sbjct: 89 RRPPPPPPPPPSSGSPPP---PPPPPPPPPPPPPPP 121 Score = 29.1 bits (62), Expect = 5.0 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPP 869 PPP PP PPP PP ++ P Sbjct: 105 PPPPPPPPPPPPPPPPPLFTRRSHAP 130 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXF 833 P PPP PP PPP F Sbjct: 107 PPPPPPPPPPPPPPPLF 123 Score = 28.3 bits (60), Expect = 8.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPP 827 P P PPP PP PPP Sbjct: 99 PSSGSPPPPPPPPPPPPPPPPP 120 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 31.5 bits (68), Expect = 0.94 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PPP P P P PP + PPP P K Sbjct: 38 PPPPPPSPVPSPAPPPPPHRPSPSPPPNPLSSK 70 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 31.5 bits (68), Expect = 0.94 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PP PPP + PPP P Sbjct: 355 PPPPPPPPPPPPVYYSSYVMLDRPPPPPP 383 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PP PPP PPP PP Sbjct: 355 PPPPPPPPPPPPVYYSSYVMLDRPPPPPP 383 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 31.1 bits (67), Expect = 1.2 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 A P G PPP P PPP P + PPP P Sbjct: 24 ATPPPAIPESGPPPPPAPDMPPPP--PTPAPQSSPAPPPAP 62 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPG 845 PPPE PP PPP P G Sbjct: 99 PPPELPPPPPPPPLPPHG 116 >04_04_0675 + 27183826-27184443 Length = 205 Score = 31.1 bits (67), Expect = 1.2 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKK 857 G + + P PPP PP PP PP K++ Sbjct: 96 GPSPSASPSQSPSPPPPASPPPLPPAPSSPPPKKRR 131 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GG P PPP PP PP G P P PPG Sbjct: 268 GGGQVPAAPPPPAGPPPPAPPPLPPSHHHHHG-HHPPPPHPLPPG 311 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXP--PXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P P PPP P PPP PP Sbjct: 323 PPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPP 354 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P P P P P PPP G PPP PG Sbjct: 348 GPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPPALPG 391 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P G PP PP P PPG PPP G Sbjct: 338 PSPSAAGAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAG 378 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPPE PP PP PP PP PP Sbjct: 432 PPPEHPP--PPESTSPPPPPTSDPPPVPPP 459 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP P PPP P PPP PP Sbjct: 430 PPPPPEHPPPPESTSPPPPPTSDPPPVPP 458 >08_02_0193 - 14073103-14073246,14073332-14073481,14073571-14073640, 14073900-14074021,14074260-14074395,14074492-14074967 Length = 365 Score = 30.7 bits (66), Expect = 1.6 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + P P P P PPP P +++ PPP PP Sbjct: 33 PTTPESCPDGPSPVAPYFAPPP--PPLCRRRRSWPPPPPP 70 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 30.7 bits (66), Expect = 1.6 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PK +K P P E P PPP PP + K P P P Sbjct: 134 PKPCEKPPPCKPEEPPK--PPPEKPPPKPECKLVPYPYP 170 >04_01_0500 - 6540769-6541482,6541819-6541877,6541965-6542064, 6542113-6542322,6542507-6542765,6544022-6544215 Length = 511 Score = 30.7 bits (66), Expect = 1.6 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +3 Query: 768 QXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 Q ++ G PPP PP PPP P ++ PPP P Sbjct: 23 QGERGAGEPPPPLPP--PPPG---PLQRRSSLPPPPP 54 >02_04_0056 + 19313422-19313967,19314035-19314168,19314263-19314398, 19314870-19314923,19314995-19315135,19315220-19315546, 19315647-19315916,19316080-19316226,19316890-19317045, 19317223-19317290,19318210-19318309,19318696-19318985, 19319074-19319274,19319840-19319902,19320263-19320356, 19320964-19321035,19321979-19322077,19322254-19322376 Length = 1006 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP P P G K P PP Sbjct: 49 PHGPPPPPPPSPSPSPSPPAGKPTKPHPESTPP 81 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP P PP ++ P P PP Sbjct: 352 GQPPAPPPPPPFAPTLPPPPPPRRKPPSPSPP 383 >12_01_0495 - 3935395-3937110 Length = 571 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP PP ++ PPG Sbjct: 5 PPPPLPPPPPPP--PPPATPQQNKAVELPPG 33 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKK--XXPPPXPP 881 P PPP P PP PP PPP PP Sbjct: 135 PPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPP 169 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PPP P + PPP P Sbjct: 227 PASPPPPSTATPPPPSPTPTTTRASPTPPPIP 258 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PP PPP P Sbjct: 212 PASPPPPSIATPPPSPASPPPPSTATPPPPSP 243 >10_02_0157 - 5954439-5954801,5956244-5956270,5956465-5956526, 5956971-5957592 Length = 357 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P PP PPP PP PPP P Sbjct: 61 PSPPLPPLTPPPAIVPPAL---PPPPPLP 86 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PPP PP PPP PP + P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPLEVVSPSP 64 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PPP PP PPP PP P PG + Sbjct: 40 PPPPPPPPPPPPPPPPPLEVVSPSPRWRRPGLR 72 >12_01_0877 - 8415186-8415272,8415696-8416310 Length = 233 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/43 (34%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +3 Query: 762 PKQXKKXPGXPP----PEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PK+ + P PP PE P PPP P + + P P P Sbjct: 156 PKKEEPKPPSPPREAEPEPEPPLPPPEEPTPLVRNEPSPAPTP 198 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PP PPP P +K P P Sbjct: 26 PPPPPPPPPPPPPPPPRPFSRKPSEPAAP 54 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/34 (38%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP--PPXP 878 P PPP P PPP P + P PP P Sbjct: 392 PAVPPPPPPTPPPPPPLLAPKQQSSGGPILPPAP 425 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 2/35 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP--PPXPP 881 P PPP PP PP K P PP PP Sbjct: 365 PPPPPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPP 399 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKK---XXPPPXPPG 884 P Q PG P PP PP G + PPP PPG Sbjct: 386 PPQPAVPPGPPAVPAPPTYPPADPAAGGYTSQPYMGAPPPPPPG 429 >03_06_0297 - 32924162-32924605 Length = 147 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPP 842 PK + P PPPE P PP PP Sbjct: 117 PKPPELDPPRPPPEVVPEPTPPDVEPP 143 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PP P P PP KK P P PP Sbjct: 171 PPPPPPPAPEPEPEPP---KKEEPQPPPP 196 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PK+ +K P PP P P P K PPP PP Sbjct: 196 PKEEEK-PEPPPAVIIVEPPAPAPEPEPEPPKKEPPPPPP 234 >03_05_0576 + 25765137-25766420 Length = 427 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PP P PPP PP PP P Sbjct: 64 GPEAPPSPSPSPSPSPPPQPSSPPPPPPSPPPAAAVSVSPPTQP 107 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A + KK G P P P P PP PPP PP Sbjct: 54 ASASRRKKRGGPEAPPSPSPSPSPS-PPPQPSSPPPPPPSPP 94 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP P PPP P + PPP P Sbjct: 27 PVAPPPPMGPPPPPPMPPVPVMYLRGVPPPPP 58 >01_06_1377 + 36764461-36765339 Length = 292 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 801 EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 E P P P + PP PPP PP Sbjct: 152 ERSPPPPEPQYPPPSSSPYYFPPPPPP 178 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/35 (31%), Positives = 15/35 (42%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 ++ P P P+ PP P + PP PP P Sbjct: 152 ERSPPPPEPQYPPPSSSPYYFPPPPPPAYSAPPPP 186 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 3/32 (9%) Frame = +3 Query: 795 PPEXPPXXPPPXFX---PPGXKKKXXPPPXPP 881 PP+ PP PP PP + PPP PP Sbjct: 638 PPQPPPPPPPTTRRSRKPPQPPSRPAPPPPPP 669 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/46 (32%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKK-------XXPPPXPP 881 ++ +K P P PP PPP PP ++ PPP PP Sbjct: 650 RRSRKPPQPPSRPAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPP 695 >01_02_0031 + 10364487-10365407 Length = 306 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/39 (35%), Positives = 14/39 (35%), Gaps = 2/39 (5%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP--PXXPPPXFXPPGXKKKXXPPP 872 P P PPP P P PPP P PPP Sbjct: 172 PPPPPALPAPPPPPAPMLPLAPPPTHVTPAMPLSSMPPP 210 >12_02_0756 + 22839673-22839870,22839961-22842194,22842280-22842531, 22842612-22842722,22842812-22842893,22843168-22843359 Length = 1022 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P+ PP PPP PP ++ PPP P Sbjct: 574 PEPPSPQHPPS-PPPLRSPP---RQPTPPPSP 601 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 762 PKQXKKXPGXPP--PEXPPXXP-PPXFXPPGXKKKXXPPPXPPG 884 P+ P P PE P P PP P + PPP PPG Sbjct: 701 PQPPSYVPSPPEYAPEPPVYAPYPPGITPSPPEYAPEPPPGPPG 744 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPG 845 P Q P P PP PPP PPG Sbjct: 136 PGQEPPPPHVPKAAPPPPPPPPPHAPPG 163 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 2/45 (4%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXP--PPXFXPPGXKKKXXPPPXPP 881 G PK PPP PP P P PP P P PP Sbjct: 208 GIKPKLKGPKGAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 A P+ + P PPP P PPP PP PP PP K Sbjct: 131 ALPRGPGQEP--PPPHVPKAAPPPPPPPP-----PHAPPGPPPTK 168 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 4/44 (9%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPP----PXPP 881 P Q P PPP P PP PP +++ PP P PP Sbjct: 55 PSQQLPPPSLPPP-LPQKQPPSQQLPPPPQQQQPPPQHSLPPPP 97 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPG 845 P PPP PP P F PPG Sbjct: 1157 PPPPPPPLPPPPPVAPFHPPG 1177 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PP PP PPP PP Sbjct: 1183 PSVPPHHGNNYHQPPSVPPPNNAYHLQPPPHPP 1215 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 29.5 bits (63), Expect = 3.8 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +3 Query: 798 PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P P PP + PPP PP Sbjct: 43 PRFAPPPPQPTLPPPPPRTLPPPPPPPP 70 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP+ PPP PP PPP PP Sbjct: 48 PPPQPTLPPPPPRTLPP---PPPPPPPQPP 74 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 K P PP P PPP PP PPP P Sbjct: 41 KCPRFAPPPPQPTLPPP---PPRTLPPPPPPPPP 71 >07_03_0906 + 22481456-22481802,22482105-22482186,22482299-22482400, 22483005-22483315,22483948-22484044,22484522-22484696, 22485074-22485150,22485632-22486027,22486254-22486303, 22487315-22487382,22488142-22488701 Length = 754 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP PPP P Sbjct: 4 PAQPPPTRPPVAAPPPSLAAAAPISVQPPPLQP 36 >07_01_0516 - 3850252-3852870 Length = 872 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPP 869 P PPP P PPP PP PP Sbjct: 16 PPQPPPTSRPLPPPPPPPPPAHGPSPPPP 44 >05_03_0039 - 7621613-7622695 Length = 360 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PK K P PE P P PG K + P P P Sbjct: 138 PKPEHKPEPKPEPEPKPYPKPKPEPKPGPKPEPKPEPKP 176 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PK K P PE P P PG K K P P Sbjct: 256 PKPEPKPYPKPKPEPKPVPKPKPIPHPGPKPKPKPDP 292 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.5 bits (63), Expect = 3.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP PPP PP Sbjct: 56 PTSPPPASPPL---PSATPPLAASPPPPPPPPP 85 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 GG P G PP PP PP PPP PP Sbjct: 1146 GGVPPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPP 1189 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 5/49 (10%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPPG 884 G P G PPP PP PPP G + PP P G Sbjct: 1096 GVAPPPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEG 1144 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPP 869 PG P P PP P PPG + PP Sbjct: 1202 PGAPAPPMPPGVPGGPPPPPGGRGLPAPP 1230 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 29.5 bits (63), Expect = 3.8 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +3 Query: 768 QXKKXPGXPPPEXPPXXPPPXFXPPGXKKK--XXPPPXPP 881 Q ++ P PPP PP PPP G + PPP PP Sbjct: 3 QQQQQP--PPPPPPPQHPPPPQAGGGGGGEFYRGPPPQPP 40 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 GG P K P PPP PP K+K PPP P Sbjct: 81 GGGKPA---KMPDSPPPSLPPPVNTGKKKWKKDKRKEIPPPPP 120 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P + P PPP P PPP PP Sbjct: 421 PPPAPSQQPQPPPPPSHPTPITSVAPAPPPPPP 453 >09_04_0324 - 16686872-16687074,16687479-16687521,16687735-16688068, 16688190-16688854 Length = 414 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXK 851 PPP PP PPP PP + Sbjct: 4 PPPSPPPPSPPPAPAPPSSR 23 >07_03_1433 + 26513728-26514135,26525534-26526280 Length = 384 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPP--PEXPPXXPPPXFXPPGXKKKXXPPP 872 G A P P P P PP PPP PP PP Sbjct: 24 GNASPPTPITYPSPPSLSPSMPPTYPPPSSTPPSPAPVSPSPP 66 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/39 (30%), Positives = 12/39 (30%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P P PPP PP PP P Sbjct: 51 PSSTPPSPAPVSPSPPTTYPPPSTTPPNPAPTSPSPPAP 89 >07_03_1432 - 26508135-26508881,26509301-26509708 Length = 384 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPP--PEXPPXXPPPXFXPPGXKKKXXPPP 872 G A P P P P PP PPP PP PP Sbjct: 24 GNASPPTPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPP 66 >07_03_1382 - 26170563-26170631,26171151-26171843 Length = 253 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PPP P G + PPP PP Sbjct: 184 PPPPPPPQ--PSGDANENPPPPPPP 206 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXF---XPPGXKKKXXPPP 872 K+ P PPP PP PP PP PPP Sbjct: 74 KQTPPPPPPPPPPPSPPATHDVGQPPPPPSLAAPPP 109 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PP PP PPP PP PPP P Sbjct: 77 PPPPPP--PPPPPSPPATHDVGQPPPPP 102 >05_03_0040 - 7646525-7647775 Length = 416 Score = 29.1 bits (62), Expect = 5.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PK K P PE P P P P KK PP PP Sbjct: 374 PKPEPKPYPEPKPEPKPK-PKPEPKPEAPPKKHKPPHIPP 412 >03_05_0388 + 23726957-23727418,23730016-23730262,23731072-23731220, 23731313-23731597,23731665-23731889,23734251-23734445 Length = 520 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/36 (38%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +3 Query: 786 GXPPPEXPPXXPP----PXFXPPGXKKKXXPPPXPP 881 G PP PP P P F PP + PPP P Sbjct: 311 GPPPSHLPPGGPGYGGHPQFMPPRPQDNYYPPPDVP 346 >02_05_1277 - 35408097-35409080 Length = 327 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PP PP P PPP PP Sbjct: 57 PSTPAPPPPPPAQPPVLAAPA---PAPPPPQPP 86 >02_03_0120 + 15463163-15465250 Length = 695 Score = 29.1 bits (62), Expect = 5.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 K G PP P PPP P PPP P Sbjct: 288 KYIGPMPPNNQPLPPPPSPSPSPPPPSPPPPPHP 321 >01_05_0534 + 22999876-23000333,23000835-23000949 Length = 190 Score = 29.1 bits (62), Expect = 5.0 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXF-XPPGXKKKXXPPPXPP 881 P++ P PPP+ P PP PP K P PP Sbjct: 46 PRRPAAPPLSPPPKTPTLSTPPTLSQPPTPVKPAAPSSSPP 86 >01_05_0225 - 19501643-19501903,19503974-19504477 Length = 254 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 822 PPXFXPPGXKKKXXPPPXPP 881 PP F PPG ++ PP PP Sbjct: 37 PPLFLPPGCGRERSTPPTPP 56 >01_03_0117 + 12684729-12685886,12685978-12686145,12686292-12686336, 12686438-12687280 Length = 737 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +3 Query: 756 AXPKQXKKXPGXPP--PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A PK P PP P P PPP F PP PP P Sbjct: 238 AMPKPPSVAPVQPPQRPPAPATKPPPSF-PPQLAPTMPPPAHAP 280 >12_02_0193 + 15242068-15242265,15242356-15244589,15244675-15244926, 15245007-15245117,15245207-15245288,15245563-15245754 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >12_01_0927 + 9196230-9196427,9196499-9197190,9197317-9198351, 9198437-9198688,9198769-9198879,9198969-9199050, 9199325-9199516 Length = 853 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 405 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 432 >11_06_0069 + 19770182-19770379,19770470-19772703,19772789-19773040, 19773121-19773231,19773321-19773402,19773677-19773868 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >11_04_0270 - 15590955-15591146,15591421-15591502,15591592-15591702, 15591783-15592034,15592120-15594353,15594444-15594641 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >11_04_0158 + 14207463-14207629,14207724-14207774,14207874-14208002, 14209342-14209447,14209491-14209601,14210042-14210098, 14210903-14211727 Length = 481 Score = 28.7 bits (61), Expect = 6.6 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 4/47 (8%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPG----XKKKXXPPPXPPGXK 890 P Q PG PP+ PP P PPG PP P G K Sbjct: 259 PPQLFNWPGHAPPQLPPGASP--LFPPGPAAFHPSSRPMPPFPGGGK 303 >10_07_0154 + 13487971-13488168,13488259-13488483,13488592-13490492, 13490578-13490829,13491110-13491191,13491466-13491657 Length = 949 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 538 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 565 >10_01_0112 - 1386762-1386953,1387228-1387309,1387399-1387509, 1387590-1387841,1387927-1388348,1388430-1390160, 1390251-1390448 Length = 995 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >09_04_0487 - 18014469-18014660,18014935-18015016,18015297-18015548, 18015634-18017789 Length = 893 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 482 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 509 >09_02_0601 + 11112201-11112386,11112471-11114080,11114345-11114579, 11115233-11115358 Length = 718 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PP P PPP PP ++ PPP P Sbjct: 416 PPEPPSPRHPSSPPPLRSPP---RQPTPPPSP 444 >09_02_0349 - 7632140-7632234,7632348-7632449,7632864-7632962, 7633517-7633622,7633897-7633978,7634068-7634178, 7634259-7634510,7634596-7635688,7636157-7636829, 7636920-7637117 Length = 936 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 418 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 445 >09_02_0131 - 4693828-4694019,4694107-4694199,4694294-4694375, 4694465-4694575,4694656-4694907,4694993-4697196 Length = 977 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 487 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 514 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/41 (34%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXF--XPPGXKKKXXPPPXP 878 P+ PPP P PPP PP + PPP P Sbjct: 49 PQPDAPAAAAPPPPAPLTPPPPKSPPPPPHIQTTDLPPPKP 89 >08_02_0758 + 20848078-20849579,20849660-20849850,20849944-20850179, 20850254-20850973 Length = 882 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKK--XXPPPXPP 881 G P P PP PP PP K + PPP PP Sbjct: 424 GIPKPAPPP--PPQKNPPPNLKGQCYGQPPPPPP 455 >08_02_0450 - 17266977-17267165,17268017-17268053,17268139-17269514, 17285369-17286055,17286146-17286343 Length = 828 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 528 PEPPSPRHPP-SPPPLRSPP---RQPTPPPSP 555 >08_02_0194 + 14084828-14085025,14085116-14085788,14085855-14087082, 14087435-14087686,14087767-14087877,14087967-14088048, 14088323-14088514 Length = 911 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 552 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 579 >08_01_0440 + 3875422-3875619,3875710-3876382,3876449-3877943, 3878029-3878280,3878361-3878471,3878561-3878642, 3878917-3879108 Length = 1000 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 552 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 579 >07_03_1713 + 28939446-28939574,28939674-28940231,28940338-28940460, 28940676-28940912 Length = 348 Score = 28.7 bits (61), Expect = 6.6 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +3 Query: 762 PKQXKKXPGX---PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P + PG P P P PPP PG + PP PPG Sbjct: 139 PPPPNREPGHGYHPAPAFYPPQPPPSHDEPGYGYR-PPPVGPPG 181 >07_03_0890 - 22332768-22333382 Length = 204 Score = 28.7 bits (61), Expect = 6.6 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPP--XXPPPXFXPPGXKKKXXPPPXPP 881 G P + P PPP PP P PP P P PP Sbjct: 73 GSPPPPPAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 118 >06_03_1445 - 30209354-30209396,30209798-30209875,30210220-30210285, 30212275-30212322,30212408-30212571,30212726-30213581, 30213673-30213786,30213853-30213996,30214075-30214304, 30214584-30214724,30214810-30214887,30214972-30215053, 30215130-30215184,30215284-30215407,30215548-30215641, 30215718-30215794,30215873-30215982,30216058-30216655 Length = 1033 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP+ PP PPG +++ P PP Sbjct: 10 PPPDRQGQVPPRGDPPPGRQRQVPPRGDPP 39 >06_03_1433 - 30129184-30129226,30129628-30129705,30130050-30130115, 30132105-30132152,30132238-30132401,30132556-30133411, 30133503-30133616,30133683-30133826,30133905-30134134, 30134414-30134554,30134640-30134717,30134802-30134883, 30134958-30135012,30135112-30135235,30135376-30135469, 30135546-30135622,30135701-30135810,30135886-30136483 Length = 1033 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP+ PP PPG +++ P PP Sbjct: 10 PPPDRQGQVPPRGDPPPGRQRQVPPRGDPP 39 >06_03_1416 + 30027066-30027663,30027739-30027848,30027927-30028003, 30028080-30028173,30028314-30028437,30028537-30028591, 30028666-30028747,30028832-30028909,30028995-30029135, 30029416-30029645,30029724-30029867,30029934-30030047, 30030139-30030994,30031149-30031312,30031398-30031445, 30033435-30033500,30033845-30033922,30034324-30034366 Length = 1033 Score = 28.7 bits (61), Expect = 6.6 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP+ PP PPG +++ P PP Sbjct: 10 PPPDRQGQVPPRGDPPPGRQRQVPPRGDPP 39 >06_03_0750 - 24140988-24141037,24141108-24141345,24142158-24142232, 24142345-24142413,24142550-24142581,24143503-24143583, 24143791-24143851,24144135-24144275,24144372-24144563 Length = 312 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P P PP PPP PP K P P G Sbjct: 38 PSPPSPPPPPPP---PPSSSSKRKPDPASKG 65 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >06_01_1155 + 9777611-9777808,9777899-9780132,9780218-9780469, 9780550-9780660,9780750-9780831,9781106-9781297 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >05_06_0026 - 25024807-25025300,25025432-25025495,25025567-25025662, 25025719-25025929,25026616-25026690,25026820-25027037 Length = 385 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P PP + P PPP PP PP P Sbjct: 11 PSPVAAAPPPPPVQVPVPPPPPPPLPPAAAAVEPLPPQP 49 >05_01_0577 + 5159934-5160131,5160222-5162455,5162541-5162792, 5162873-5162983,5163073-5163154,5163429-5163620 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >05_01_0571 - 5067558-5067749,5068024-5068105,5068195-5068305, 5068386-5068637,5068723-5070956,5071047-5071244 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >05_01_0142 - 940421-940701,941262-941574 Length = 197 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P Q G PPP PP + PP P PP Sbjct: 28 GYPPHQGYPPQGYPPPPGAYPPPPGAYPPPPGAYPPPPGAYPP 70 >04_03_0709 + 18902507-18902704,18902795-18905028,18905114-18905365, 18905446-18905556,18905646-18905727,18906002-18906193 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPP-SPPPLRSPP---RQPTPPPSP 601 >04_01_0365 - 4796780-4796971,4797246-4797327,4797417-4797527, 4797608-4797859,4797945-4800115 Length = 935 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 487 PEPPSPRHPP-SPPPLRSPP---RQPTPPPSP 514 >02_04_0021 + 18975992-18976408 Length = 138 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PPP P PPP P K P P PP K Sbjct: 97 PPPPKPKPTPPP---PAPTPKPPAPSPSPPPPK 126 >02_01_0706 + 5270233-5270326,5270767-5270914,5271018-5271089, 5271153-5271263,5271363-5271434,5271533-5271604, 5272126-5272197,5272281-5272346,5272426-5272491, 5272601-5272971,5273203-5273456,5273886-5274157, 5274333-5274474,5275174-5275313,5275381-5275537, 5275797-5275965,5276048-5276088 Length = 772 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFX--PPGXKKKXXPPPXP 878 A P + P P PP PPP PP K+ P P Sbjct: 271 ASPSFTRSAHSPPTPHPPPSSPPPPMSPPPPAVKENLKHKPEP 313 >02_01_0374 - 2702804-2702995,2703270-2703351,2703441-2703551, 2703632-2703883,2703969-2704798,2704895-2706202, 2706293-2706490 Length = 990 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 542 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 569 >01_06_1321 + 36280691-36281269 Length = 192 Score = 28.7 bits (61), Expect = 6.6 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPP 842 PPP PP PPP PP Sbjct: 143 PPPSPPPPPPPPPPLPP 159 >01_06_0075 - 26201231-26201422,26201697-26201778,26201868-26201978, 26202059-26202310,26202396-26204629,26204720-26204917 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PEPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >01_05_0224 + 19485296-19485493,19485584-19487817,19487903-19488154, 19488235-19488345,19488435-19488516,19488791-19488982 Length = 1022 Score = 28.7 bits (61), Expect = 6.6 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP PP ++ PPP P Sbjct: 574 PKPPSPRHPPS-PPPLRSPP---RQPTPPPSP 601 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PP PPP PP PP P Sbjct: 75 PPPTPPSPPPPPPPPPTNGTLTPPPSSAP 103 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PP PP P PP Sbjct: 136 PPPPPPSHPALLPPDATAPPPPPTSVAALPPPP 168 >11_08_0048 - 28022335-28022520,28022607-28022699,28022804-28022882, 28022951-28023061,28023133-28023390,28023468-28023970, 28024094-28024729,28024778-28025116 Length = 734 Score = 28.3 bits (60), Expect = 8.8 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PP PP PP PPG + PP Sbjct: 290 PPVASPPRPEPPVASPPGSEPPVASPP 316 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 28.3 bits (60), Expect = 8.8 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXF 833 P PPP+ PP PPP + Sbjct: 44 PPPPPPKPPPTVPPPSY 60 >11_02_0065 - 7938007-7938393,7939292-7939435,7940597-7940665, 7940762-7940809,7941488-7941584,7941688-7941767, 7941841-7941912,7942256-7942350,7943903-7943984, 7945176-7945209,7945255-7945262,7945657-7946058 Length = 505 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +1 Query: 466 PPPXXKXFFFXAPXPXSPKKKXAPRXXGGG 555 PPP FF P P P + P GGG Sbjct: 67 PPPPPAAFFAAVPPPPPPPFEYYPAVGGGG 96 >08_02_1553 + 27835320-27835364,27836853-27836966,27837062-27837457, 27837751-27837822,27837957-27838082,27838164-27838244, 27838364-27838558,27839018-27840013 Length = 674 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 5/38 (13%) Frame = +3 Query: 792 PPP-----EXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PPP PP PPP P PPP PP + Sbjct: 481 PPPLPAAHNVPPRPPPPVNAAPEAAIPRPPPPVPPATR 518 >08_02_0839 + 21693348-21694853 Length = 501 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PPP PP + + PPP P Sbjct: 24 PLPYLPPPPPPPQ--PPLLQLQPPPPPSSP 51 >06_03_1172 - 28147957-28148274,28149362-28149877 Length = 277 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 3/36 (8%) Frame = +3 Query: 783 PGXPPPEXP---PXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P P PP F PP P PP Sbjct: 11 PPPPPPSPPSVYPFLPPATFIPPPPPAATAEPYAPP 46 >06_01_0039 - 386576-387098,387173-387468,387744-388067,388165-388276, 388355-388482,388914-389048,389122-389250,389620-389787, 389897-390019,390099-390227,390543-390866,390946-392901 Length = 1448 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/37 (32%), Positives = 16/37 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P + + PPP P PP PP + + PPP Sbjct: 38 PSRPEPDQAAPPPPPQPHTAPPP-PPPNAEPEAPPPP 73 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 28.3 bits (60), Expect = 8.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 11/44 (25%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-----PXFXP------PGXKKKXXPPPXPP 881 P PPP PP PP P P P K PPP PP Sbjct: 115 PSPPPPPPPPPPPPTTTTKPESLPAEADSEPELKAPPPPPPPPP 158 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PP P P P PP Sbjct: 62 PSSPPPLPPLQPTPPPLPPTTLSCSSHPTPPPP 94 >04_03_0925 - 20856628-20856690,20856786-20856845,20856924-20857001, 20857127-20857192,20857542-20858675,20858991-20860283 Length = 897 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P P PPP G + P P PP Sbjct: 13 PPTPAPAPAPASPPPHPAASGNEAAAPPKPNPP 45 >04_03_0904 + 20717005-20718087 Length = 360 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +3 Query: 762 PKQXKKXPGXPPPEX----PPXXPPPXFXPPGXKKKXXPPPXPP 881 P K P PP P PPP + P K P P PP Sbjct: 215 PPSYKPQPKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNPP 258 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP PPP PP PPP G K Sbjct: 173 PPPPPPPAIWPPQPSFYYYPPPPCGGYK 200 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 28.3 bits (60), Expect = 8.8 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXP----PGXKKKXXPPPXPP 881 G PPP PP PP P PPP PP Sbjct: 44 GSPPPPSPPPPPPLDEETLAQFPSPPTNPSPPPPPP 79 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 28.3 bits (60), Expect = 8.8 Identities = 12/22 (54%), Positives = 12/22 (54%), Gaps = 1/22 (4%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP-PG 845 P PPP PP PPP P PG Sbjct: 425 PYAPPPPPPPPPPPPQALPLPG 446 >02_04_0654 - 24755339-24755408,24755488-24755624,24756243-24756326, 24756929-24756944,24758035-24758405 Length = 225 Score = 28.3 bits (60), Expect = 8.8 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 7/40 (17%) Frame = +3 Query: 792 PPPEXPPXXP-------PPXFXPPGXKKKXXPPPXPPGXK 890 PPP PP P PP P K PPP PP K Sbjct: 33 PPPPPPPLFPAMSARPQPPRPAHPARFVKPMPPPPPPFPK 72 >02_02_0663 - 12740733-12741104,12741260-12741326,12741709-12741809, 12741852-12742273,12743678-12743685,12745164-12745396 Length = 400 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 K+ PPP PP PPP P + + PPP Sbjct: 41 KRPRWEPPPYLPP--PPPYPIPQPARPRAAPPP 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,568,646 Number of Sequences: 37544 Number of extensions: 319025 Number of successful extensions: 5782 Number of sequences better than 10.0: 155 Number of HSP's better than 10.0 without gapping: 1438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4254 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2530383840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -