BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O10 (897 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 44 2e-04 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 42 9e-04 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 39 0.006 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 36 0.034 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 36 0.044 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 34 0.18 SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.31 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 33 0.31 SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) 33 0.41 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 33 0.41 SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) 33 0.41 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.41 SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) 33 0.41 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 33 0.41 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 32 0.55 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 32 0.55 SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 32 0.72 SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.72 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 32 0.72 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.72 SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) 31 0.96 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 31 0.96 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 31 1.3 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 31 1.3 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) 31 1.7 SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) 31 1.7 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) 30 2.2 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 30 2.9 SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 29 3.9 SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.9 SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.1 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 29 5.1 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 29 5.1 SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 6.0 SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 6.7 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 29 6.7 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 29 6.7 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.7 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 28 8.9 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) 28 8.9 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P Q P PPP PP PPP PP PPP PP Sbjct: 392 PPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPP 431 Score = 41.5 bits (93), Expect = 9e-04 Identities = 16/33 (48%), Positives = 17/33 (51%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PP + PPP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPP 403 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + P PPP PP PPP PP PPP PP Sbjct: 389 PPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPP 428 Score = 41.5 bits (93), Expect = 9e-04 Identities = 17/40 (42%), Positives = 18/40 (45%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + P PPP PP PPP PP PPP PP Sbjct: 390 PPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPP 429 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PPP PP PPP PP Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPP 410 Score = 41.1 bits (92), Expect = 0.001 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PPP PP PPP PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Score = 40.7 bits (91), Expect = 0.002 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PPP PP PPP PP Sbjct: 391 PPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Score = 39.1 bits (87), Expect = 0.005 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PP PPP PP + PPP PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPP 404 Score = 38.7 bits (86), Expect = 0.006 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P PPP PP PPP PP PPP P Sbjct: 380 PPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 38.3 bits (85), Expect = 0.008 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP PP PPP PP Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPP 414 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP P PPP PP PPP PP Sbjct: 372 PPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPP 411 Score = 37.9 bits (84), Expect = 0.011 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PP PPP PP PPP PP Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP 415 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P P PP PPP PP PPP PP Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPP 405 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP P P PP PPP PP Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP 413 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP P PPP PP PPP PP Sbjct: 379 PPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PP PPP PP PPP PP Sbjct: 382 PPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 Score = 37.5 bits (83), Expect = 0.015 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PPP PP PP PP Sbjct: 385 PPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 37.5 bits (83), Expect = 0.015 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P P PPP PP PPP PP PPP PP + Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPAPPP---PPPPPPPPPPALR 435 Score = 37.1 bits (82), Expect = 0.019 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPP-PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP P PP PPP PP PPP PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPP 409 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP P PP PP PPP PP Sbjct: 373 PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP 412 Score = 34.3 bits (75), Expect = 0.14 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPP 869 P P PPP PP PPP PP + PP Sbjct: 406 PPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P P PPP PP PPP PP + PP Sbjct: 405 PPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAPP 441 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 42.3 bits (95), Expect = 5e-04 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPP--PXPP 881 GG P P PPP PP PPP + PP PP P PP Sbjct: 81 GGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPP 126 Score = 36.7 bits (81), Expect = 0.025 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPP-XFXPPGXKKKXXPPPXPP 881 P P PPP PP PPP PP PPP PP Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPP 210 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PPP PP PPP PP Sbjct: 164 PPNPPPPNAPYPPPPY--PPPPNPPYPPPPNPP 194 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXF-XPPGXKKKXXPPPXPP 881 P PPP PP PPP PP PPP P Sbjct: 106 PPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAP 139 Score = 33.9 bits (74), Expect = 0.18 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PP PP PPP PP Sbjct: 123 PYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPP 155 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PP PPP PP PPP PP Sbjct: 150 PPPNPPYPPPLYPPPP-NPPPPNAPYPPPPYPP 181 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXF-XPPGXKKKXXPPPXPP 881 P PPP PP PPP PP PPP P Sbjct: 185 PPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAP 218 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP P PPP PP Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPP 186 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXP-PPXFXPPGXKKKXXPPPXPP 881 P P PP PP P PP PP PPP P Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPPNP 239 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PPP P PP PP Sbjct: 193 PPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPP 225 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PP PP P P PP Sbjct: 194 PYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPP 226 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 2/37 (5%) Frame = +3 Query: 777 KXPGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPP 881 K G PP P PPP + P PPP PP Sbjct: 79 KCGGHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPP 115 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P P PP PP PPP PP Sbjct: 136 PNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 41.5 bits (93), Expect = 9e-04 Identities = 18/40 (45%), Positives = 19/40 (47%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P Q + P PPP PP PPP PP PPP PP Sbjct: 198 PSQITQPP--PPPPRPPPSPPPPPPPPSPSPPRPPPPPPP 235 Score = 38.3 bits (85), Expect = 0.008 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 768 QXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 Q P PPP PP PPP PP + PPP PP Sbjct: 203 QPPPPPPRPPPSPPPPPPPPSPSPP--RPPPPPPPSPP 238 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P P P PP PPP P K PPP P Sbjct: 221 PPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIP 252 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 38.7 bits (86), Expect = 0.006 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 G A P P PPP PP PPP F PP PPP P Sbjct: 461 GQAPPPPPPPPPPPPPPPPPPPPPPPPFPPP-------PPPTP 496 Score = 38.7 bits (86), Expect = 0.006 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP PPP PP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP PPP PP PPP PP Sbjct: 461 GQAPPPPPPPPPPP--PPPPPPPPPPPPPFPP 490 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 37.9 bits (84), Expect = 0.011 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +3 Query: 768 QXKKXPGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 Q + PG P P PP P P F PPG PPP P Sbjct: 419 QRVRPPGAPHPRVPPPGAPHPRFPPPGAPHPRVPPPGAP 457 Score = 36.3 bits (80), Expect = 0.034 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 P Q PG P P PP P P PPG PPP P Sbjct: 497 PHQRVPPPGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 537 Score = 34.7 bits (76), Expect = 0.10 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG + PPP P Sbjct: 474 PGAPHPRVPPPGAPHPRVPPPGAPHQRVPPPGAP 507 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPPGXK 890 PG P P PP P P PPG PPP P K Sbjct: 564 PGAPHPRVPPPGAPHPRVPPPGTPHPRVPPPGAPHPK 600 Score = 34.3 bits (75), Expect = 0.14 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 534 PGAPHPRVPPPGAPHPRVPPPGASHPRVPPPGAP 567 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 434 PGAPHPRFPPPGAPHPRVPPPGAPHPRVPPPGAP 467 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 444 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 477 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 454 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 487 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 464 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 497 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 514 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPPGAP 547 Score = 33.9 bits (74), Expect = 0.18 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P P PPG PPP P Sbjct: 574 PGAPHPRVPPPGTPHPRVPPPGAPHPKVPPPGAP 607 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPP 872 PG P P PP P P PPG PPP Sbjct: 524 PGAPHPRVPPPGAPHPRVPPPGAPHPRVPPP 554 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P PPG PPP P Sbjct: 484 PGAPHPRVPPPGAPHQRVPPPGAPHPRVPPPGAP 517 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P PP P P PPG PPP P Sbjct: 494 PGAPHQRVPPPGAPHPRVPPPGAPHPRVPPPGAP 527 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P P PP P PPG PPP P Sbjct: 544 PGAPHPRVPPPGASHPRVPPPGAPHPRVPPPGAP 577 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPP-PXFXPPGXKKKXXPPPXPP 881 PG P PP P P PPG PPP P Sbjct: 554 PGASHPRVPPPGAPHPRVPPPGAPHPRVPPPGTP 587 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-PXXPPPX-----FXPPGXKKKXXPPPXPP 881 P P PPP P P PPP PPG PPP P Sbjct: 392 PSPGASHPRVPPPGAPHPRVPPPGASHQRVRPPGAPHPRVPPPGAP 437 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 783 PGXPPPEXPPXX---PPPXFXPPGXKKKXXPPPXP 878 PG PPP+ P PP PPG PP P Sbjct: 297 PGYPPPQYMPHPRMRPPTRIPPPGMGPPPRIPPPP 331 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 PG P P+ PP P P G PPP PP Sbjct: 594 PGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGPP 627 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 37.1 bits (82), Expect = 0.019 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PP PPP PP + PPP P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 36.7 bits (81), Expect = 0.025 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PP PPP PP + PPP PP Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPPPP 711 Score = 35.9 bits (79), Expect = 0.044 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P Q P PPP PP PPP PP PPP P Sbjct: 677 PIQTMVPPPPPPPPPPPPPPPP--PPPQPSTPPPPPPSTP 714 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.1 bits (82), Expect = 0.019 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P K P PP PP PPP PP PP PP Sbjct: 369 PPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPP 408 Score = 35.5 bits (78), Expect = 0.059 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXF--XPPGXKKKXXPPPXPP 881 P K P PPP P PPP PP PPP PP Sbjct: 368 PPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 35.1 bits (77), Expect = 0.078 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PP PPP PP PP PP Sbjct: 359 PPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 34.7 bits (76), Expect = 0.10 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPP--EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP PP PPP PP Sbjct: 348 PPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPP 389 Score = 34.3 bits (75), Expect = 0.14 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPP--EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP + PP PP PP PPP PP Sbjct: 358 PPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPP 399 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPP-XFXPPGXKKKXXPPPXPP 881 P PP PP PPP PP PPP PP Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPP 379 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP PP PPP PP Sbjct: 384 PPPPPPPTNGPP---PPPPPTNGPPPPPPP 410 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 G PPP P PPP PP PPP P Sbjct: 383 GPPPPPPPTNGPPP---PPPPTNGPPPPPPP 410 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P PP PP PPP PP PP Sbjct: 386 PPPPPTNGPPPPPPPTNGPPPPPPPTNGPP 415 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPP 869 P PP PP PPP PP K P Sbjct: 396 PPPPPTNGPPPPPPPTNGPPSEGKCGRKP 424 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 36.3 bits (80), Expect = 0.034 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP P P P F PP + + PP PPG Sbjct: 1255 PPPGMRPMPPQPPFMPPPPRMQPPGPPGPPG 1285 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP+ P PPP PPG PP P K Sbjct: 1263 PPQPPFMPPPPRMQPPGPPGPPGPPGPQPSNK 1294 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP PPP P G K PP PPG + Sbjct: 1235 PP--PPPAMPPDGPPKFMGLPPPPPGMR 1260 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/31 (41%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = +3 Query: 792 PPPEXPPXXPPPXF-XPPGXKKKXXPPPXPP 881 PPP PP PP PP PP PP Sbjct: 1237 PPPAMPPDGPPKFMGLPPPPPGMRPMPPQPP 1267 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 36.3 bits (80), Expect = 0.034 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GGA P P PP PP PPP P PPP PPG Sbjct: 359 GGAAPPP----PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 35.9 bits (79), Expect = 0.044 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PPP PP PPP PP Sbjct: 305 PPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPPP 337 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/43 (39%), Positives = 17/43 (39%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 G A PG PP PP PP PPG PPP P Sbjct: 299 GSAPAPPPPPPPGGAPPPPPPPPPP----PPGDGGAPPPPPPP 337 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PPP PP PPP PP Sbjct: 304 PPPPPPPGGAPPPPPPPPPPPPGDGGAPPPPPP 336 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP + PPP PPG PPP PP Sbjct: 292 PPPPPADGSAPAPPPP-PPPGGAPPPPPPPPPP 323 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/45 (40%), Positives = 18/45 (40%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GGA G P PP PPP PP PPP PPG Sbjct: 287 GGAPVPPPPPADGSAPAPPPP--PPPGGAPP---PPPPPPPPPPG 326 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect = 0.10 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PP P P PP + PPP PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 Score = 33.1 bits (72), Expect = 0.31 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP P P PP Sbjct: 66 PPPAAAPAAPPPPAAPPAAPPPPPPLPAPP 95 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP P PP PPP P Sbjct: 52 PPPPSPPAAAPAAPPPPAAAPAAPPPPAAP 81 Score = 29.1 bits (62), Expect = 5.1 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP P PPP P PP PP Sbjct: 54 PPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPP 86 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/44 (45%), Positives = 21/44 (47%), Gaps = 7/44 (15%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXP-----PPXF--XPPGXKKKXXPPPXPPG 884 KK G PPP PP P PP PPG + PPP PPG Sbjct: 771 KKALGAPPPPPPPTKPATPRVPPNIPSRPPG--ARPTPPPPPPG 812 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 A P+ P PP P PPP P K PP PPG Sbjct: 787 ATPRVPPNIPSRPPGARPTPPPPPP-GKPTKPTKPSLPPVPPG 828 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 9/53 (16%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXX---------PPPXFXPPGXKKKXXPPPXPP 881 GG+ P Q G PP PP PP PPG PPP PP Sbjct: 938 GGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPP 990 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/45 (33%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GG+ P G P PP PP PPP PPG Sbjct: 916 GGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPG 960 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 2/49 (4%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEX--PPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 G A P PPP PP PPP P PPP PP K Sbjct: 950 GNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP-PPPPPPPPPPPPMRK 997 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P PPP PP P PP PP P G Sbjct: 906 GSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGG 950 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/45 (44%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +3 Query: 756 AXPKQXKKXPGXPP-PEX-PPXXPPPXFX-PPGXKKKXXPPPXPP 881 A PKQ K P PP P+ P PPP PP PPP PP Sbjct: 203 AAPKQQKATPVNPPEPDYLEPTPPPPAAPAPPPPPAAAPPPPPPP 247 Score = 33.1 bits (72), Expect = 0.31 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P+ P PPP P PPP PP PPP PP K Sbjct: 216 PEPDYLEPTPPPPAAPAPPPPPAAAPP-------PPPPPPPVK 251 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPP-EXPPXXPPPXFXP--PGXKKKXXPPPXPPG 884 G P PG PPP PP PP P G PPP PPG Sbjct: 239 GAPPPPHSMPPPGMPPPGMMPPPGFPPMGMPGMGGMPPPGMPPPMPPG 286 >SB_5243| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 924 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PPP PPG + PPP PP Sbjct: 781 PTTPPPEYPPP---PPGLARPNPPPPNPP 806 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PPP PG PPP PP Sbjct: 715 PPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPP 747 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/41 (43%), Positives = 18/41 (43%), Gaps = 7/41 (17%) Frame = +3 Query: 783 PGXPPPEXP------PXXPPPXFXPPGXKKKXXPPPXP-PG 884 P PPP P P PPP PPG PPP P PG Sbjct: 695 PPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPG 735 Score = 29.1 bits (62), Expect = 5.1 Identities = 17/51 (33%), Positives = 19/51 (37%), Gaps = 11/51 (21%) Frame = +3 Query: 765 KQXKKXPGXPPP-----------EXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 ++ KK P PPP PP PPP PPP PPG Sbjct: 671 EKLKKVPPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPG 721 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PPP PPG PPP PP Sbjct: 729 PPSPQPGCAGLPPPPPPPPPGCA--GLPPPPPP 759 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP P PPP PP Sbjct: 1157 PPPPPPPPPPPP--SSPSPPPPPPPPPPPP 1184 Score = 32.7 bits (71), Expect = 0.41 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +3 Query: 801 EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 + PP PPP PP PPP PP Sbjct: 1155 QIPPPPPPPPPPPPSSPSPPPPPPPPP 1181 Score = 32.7 bits (71), Expect = 0.41 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PP PP PP PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 33.1 bits (72), Expect = 0.31 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PPP PPG P P PPG Sbjct: 654 PPPPGGGMFPPPPPPPPGGGVPGPPKPPPPG 684 >SB_47282| Best HMM Match : RCSD (HMM E-Value=0.53) Length = 264 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXP 866 PPP PP PPP PPG KK P Sbjct: 79 PPPPPPPPPPPPP--PPGAKKPDDP 101 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 819 PPPXFXPPGXKKKXXPPPXPPGXK 890 PPP PP PPP PPG K Sbjct: 73 PPPLCAPPPPPPPPPPPPPPPGAK 96 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PPP PPG + PPP PP Sbjct: 656 PEAGPPPPPPP---PPGGQAGGAPPPPPP 681 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PPP PP PP PPP PPG Sbjct: 674 GAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPPG 706 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/43 (34%), Positives = 16/43 (37%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 A P+ P PPP PP PP PPP P G Sbjct: 654 ATPEAGPPPPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIG 696 >SB_11994| Best HMM Match : ERM (HMM E-Value=0.28) Length = 465 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXP 866 PPP PP PPP PPG KK P Sbjct: 280 PPPPPPPPPPPPP--PPGAKKPDDP 302 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 819 PPPXFXPPGXKKKXXPPPXPPGXK 890 PPP PP PPP PPG K Sbjct: 274 PPPLCAPPPPPPPPPPPPPPPGAK 297 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPP-GXKKKXXPPPXPP 881 P G PP PP PPP PP G PP PP Sbjct: 2175 PPMGAPPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPPMGPP 2215 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/38 (36%), Positives = 14/38 (36%), Gaps = 1/38 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPP-EXPPXXPPPXFXPPGXKKKXXPPP 872 P P PPP PP PPP PP PP Sbjct: 2164 PSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPPPMGTPP 2201 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP-GXKKKXXPPPXPP 881 G P PP PPP PP G PP PP Sbjct: 2163 GPSPLGAPPSVPPPMGAPPSGPPPMGAPPSGPP 2195 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 G PP PP PP PP PPP Sbjct: 2188 GAPPSGPPPMGTPPSGHPPMGAPPMGPPP 2216 >SB_30592| Best HMM Match : MAM (HMM E-Value=2.66247e-44) Length = 667 Score = 32.7 bits (71), Expect = 0.41 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PP PP PPP PP + PPP P G Sbjct: 430 PPPTPPPTPPPTPPPTTLPPTTQ----PPPQPTG 459 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 32.7 bits (71), Expect = 0.41 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P+ + P PPP P P PP PPP PP Sbjct: 117 PETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPP 156 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP PP PPP PP P PPG Sbjct: 190 PPSGGPPPPPPPPPPPPPPPILELAAPPPPG 220 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 + P PPP P PP PP PPP PP Sbjct: 136 RAPPPPPPIAPATGGPPP-PPPIAPATGGPPPPPP 169 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 783 PGXPP--PEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PE P P P PP PPP PP Sbjct: 110 PPPPPRAPETPSQAPSPP-PPPTSPATRAPPPPPP 143 Score = 28.3 bits (60), Expect = 8.9 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPP 827 A P P PPP PP PPP Sbjct: 186 ASPPPPSGGPPPPPPPPPPPPPPP 209 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-----PXXPPPXFXPPGXKKKXXPPPXP 878 P + P PP P P PPP PP K PPP P Sbjct: 350 PTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 393 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPP 872 PPP PP PPP P G K PPP Sbjct: 2 PPPPPPPGPPPPPSAPSGPVK---PPP 25 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPP-EXPPXXPPPX-----FXPPGXKKKXXPPPXP 878 G P + P PPP P PPP PP + + PPP P Sbjct: 297 GPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 345 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P K P P PPP PP PP PP Sbjct: 260 GGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 302 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXX----PPPXFXPPGXKKKXX--PPPXPPGXK 890 P + + P PP PP PPP PPG + PPP PPG + Sbjct: 334 PLRGQIAPPPPPISKPPTSTRSAPPP---PPGRAPQPLGGPPPPPPGRR 379 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + + P P PPP PP K+ PP PP Sbjct: 245 PGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 284 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPP-EXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P + P PPP PPP P + PPP PPG Sbjct: 322 PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP-PPG 362 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/38 (39%), Positives = 18/38 (47%), Gaps = 2/38 (5%) Frame = +3 Query: 774 KKXPGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPP 881 ++ PG PP P PPP + PG PPP PP Sbjct: 369 QRPPGMRPPGAGNGPGGPPPPWSKPGGILPGPPPPGPP 406 Score = 31.9 bits (69), Expect = 0.72 Identities = 15/40 (37%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP + P PP PPG + PPP PP Sbjct: 405 PPMLNMAPSIPPWQTTPGYIPPP--PPGFPQFQPPPPPPP 442 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/51 (37%), Positives = 19/51 (37%), Gaps = 3/51 (5%) Frame = +3 Query: 741 NXXGGAXPKQXKKX---PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 N GG P K PG PPP PP PP PP PPG Sbjct: 381 NGPGGPPPPWSKPGGILPGPPPP-GPPMLNMAPSIPPWQTTPGYIPPPPPG 430 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 32.3 bits (70), Expect = 0.55 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 5/44 (11%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-----PXXPPPXFXPPGXKKKXXPPPXP 878 P + P PP P P PPP PP K PPP P Sbjct: 262 PTSTRSAPPPPPGRAPQPLGGPPPPPPGRRPPSGKINPPPPPPP 305 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 6/49 (12%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPP-EXPPXXPPPX-----FXPPGXKKKXXPPPXP 878 G P + P PPP P PPP PP + + PPP P Sbjct: 209 GPPLPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPP 257 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P K P P PPP PP PP PP Sbjct: 172 GGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPP 214 Score = 28.7 bits (61), Expect = 6.7 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 6/49 (12%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXX----PPPXFXPPGXKKKXX--PPPXPPGXK 890 P + + P PP PP PPP PPG + PPP PPG + Sbjct: 246 PLRGQIAPPPPPISKPPTSTRSAPPP---PPGRAPQPLGGPPPPPPGRR 291 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/40 (32%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + + P P PPP PP K+ PP PP Sbjct: 157 PGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPP 196 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPP-EXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P + P PPP PPP P + PPP PPG Sbjct: 234 PPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP-PPG 274 >SB_21461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXP-PXXPPPXFXPPGXKKKXXPPPXPP 881 PG PPP P P PPP PG P P P Sbjct: 50 PGDPPPNIPIPGNPPPNTPIPGDPPPNTPIPGDP 83 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-PXXPPPXFXPPGXKKKXXPPPXPP 881 P PG PPP P P PPP PG PPP P Sbjct: 83 PPPNTPIPGNPPPNTPIPGDPPPNTPIPG-----DPPPNTP 118 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-PXXPPPXFXPPGXKKKXXPPPXPP 881 P PG PPP P PPP PG + P P P Sbjct: 13 PPPNTAIPGDPPPNTTIPRAPPPNTAIPGDRPPNTPIPGDP 53 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +3 Query: 762 PKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PG PPP + PP P P PP PPP P Sbjct: 63 PPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTPIPGDPPPNTP 108 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PPP + PP P P PP PPP P Sbjct: 60 PGNPPPNTPIPGDPPPNTPIPGDPPPNTPIPGNPPPNTP 98 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 31.9 bits (69), Expect = 0.72 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP--PPXPPG 884 PG P P PP P P PPG K P P PPG Sbjct: 625 PGPPGPASPPSPPGPP-GPPGPKGPPGPNGPLGPPG 659 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGX--PPPEXPPXXPPPXFXPPGXKKKXXP--PPXPPGXK 890 N G P PG PP + PP PPG P PP PPG K Sbjct: 763 NPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPK 816 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 4/54 (7%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGX--PPPEXPPXXPPPXFXPPGXKKKXXP--PPXPPGXK 890 N G P PG PP + PP PPG P PP PPG K Sbjct: 848 NPAGSQGPNGQPGPPGINGPPGQVGEMGPPGLPGPPGPASPPSPPGPPGPPGPK 901 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXK-KKXXP-PPXPPG 884 PG P P+ PP P P P G K P PP PPG Sbjct: 42 PGPPGPDGPPGFPGPQ-GPNGPKGPPGLPGPPGPPG 76 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP--PPXPPG 884 PG P P PP P P PPG P P PPG Sbjct: 710 PGPPGPASPPSPPGPP-GPPGPNGPPGPNGPLGPPG 744 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 4/38 (10%) Frame = +3 Query: 783 PGXPPPEXP--PXXPPPXFXPPGXKKKXXP--PPXPPG 884 PG P P P P PP PPG K P P PPG Sbjct: 792 PGLPGPPGPASPPSPPGPPGPPGPKGPPGPNGPLGPPG 829 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPP--PXPPG 884 PP E PP PPG + PP P PPG Sbjct: 102 PPGELGDMGPPGPPGPPGPQMPPGPPGLPGPPG 134 Score = 28.3 bits (60), Expect = 8.9 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 7/41 (17%) Frame = +3 Query: 783 PGXPPPEXPPXXP-----PPXFXPPGXKKKXXPP--PXPPG 884 PG P P+ PP P P PPG + PP PPG Sbjct: 115 PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPGDVGPPG 155 Score = 28.3 bits (60), Expect = 8.9 Identities = 19/54 (35%), Positives = 19/54 (35%), Gaps = 4/54 (7%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGX--PPPEXPPXXPPPXFXPPGXKKKXXP--PPXPPGXK 890 N G P PG PP E P PPG P PP PPG K Sbjct: 593 NPAGPQGPNGQPGPPGVNGPPGEIGEIGPAGLPGPPGPASPPSPPGPPGPPGPK 646 Score = 28.3 bits (60), Expect = 8.9 Identities = 18/52 (34%), Positives = 19/52 (36%), Gaps = 4/52 (7%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGX--PPPEXPPXXPPPXFXPPGXKKKXXP--PPXPPG 884 N G P PG PP + PP PPG P PP PPG Sbjct: 678 NPAGVQGPNGQPGPPGINGPPGQIGEMGPPGLPGPPGPASPPSPPGPPGPPG 729 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 31.9 bits (69), Expect = 0.72 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPP---XXPPPXFXPPGXKKKXXPPPXPP 881 G P G PPP PP PPP F P + + P PP Sbjct: 283 GPPPHMPPDYRGFPPPNFPPPDFSRPPPNFNDPAFQGRPPPFVRPP 328 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 31.9 bits (69), Expect = 0.72 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PP P K PPP PP Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPP 583 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P E PP PP PP P P PP Sbjct: 546 PAVTPSEEPPPPPPGVDIPPPLPPSEDPKPPPP 578 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +3 Query: 783 PGXPPP--EXPPXXPP---PXFXPPGXKKKXXPPPXPPG 884 P PPP + PP PP P PP + PP PPG Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPG 592 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/28 (50%), Positives = 15/28 (53%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPG 845 P + K P PPPE P PPP PPG Sbjct: 569 PSEDPKPP-PPPPEPPEECPPP---PPG 592 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 31.9 bits (69), Expect = 0.72 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P Q + G P PP PP PPG + PPP Sbjct: 436 PPQPRPPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPP 472 Score = 28.7 bits (61), Expect = 6.7 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 2/43 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPP--PXPPG 884 P + P P PP PP P G PP P PPG Sbjct: 421 PAANMRLPPPPQHTGPPQPRPPHGMPQGGGPPQLPPNLPPPPG 463 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 5/34 (14%) Frame = +3 Query: 786 GXPPPEX-----PPXXPPPXFXPPGXKKKXXPPP 872 G PPP P PPP F PP + PPP Sbjct: 467 GMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 >SB_15263| Best HMM Match : Jun (HMM E-Value=1.8) Length = 315 Score = 31.5 bits (68), Expect = 0.96 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 783 PGXPPPEXPPXXPP---PXFXPPGXKKKXXPPPXPP 881 P PP PP PP P PP + PPP PP Sbjct: 177 PRTQPPPIPPIDPPRTQPPPIPPIDPPRTQPPPIPP 212 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXX--PPPXFXPPGXKKKXXPPPXPPG 884 PG P PP PPP PPG PPP PPG Sbjct: 201 PGQPGMWGPPPMGGPPPMGGPPGG---YPPPPPPPG 233 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 G PP PP PP PPG PPP Sbjct: 214 GPPPMGGPPGGYPPPPPPPGAGDPAYPPP 242 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPP 842 G + ++ + P PPP PP PPP PP Sbjct: 853 GRSRYRRPRPRPRRPPPPPPPPPPPPPPPPP 883 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P+ + P PPP PP PPP PP P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPP-PPPASSTGSTP 893 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PPP PP PPP F PG PPP PP Sbjct: 193 GMPPP--PPPPPPPGF--PGG---APPPPPPP 217 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.3 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P P P F G PPP PP Sbjct: 179 PAPPPPGAPAAPPAPPFG--GPPSAPPPPPAPP 209 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP P PP + PPP PP Sbjct: 298 GFQPPPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 28.3 bits (60), Expect = 8.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP P F G + PPP PP Sbjct: 281 PPPPPPPSNTPGMFASSGFQ----PPPPPP 306 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P + K G P P+ PP PPG + PP PPG Sbjct: 3800 PGRSKNISGPPGPQGPPGQASQIPGPPGPQGPPG-PPGPPG 3839 >SB_8802| Best HMM Match : WW (HMM E-Value=3.2e-31) Length = 662 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEX-PPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PG PPP PP PP PG P P PG Sbjct: 366 PPMALSLPGMPPPGLLPPPGMPPRLPIPGLGLPGMPLPGMPG 407 >SB_1457| Best HMM Match : VHS (HMM E-Value=2e-31) Length = 892 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 G A P Q P PPP P P + P G + PP Sbjct: 824 GAAAPNQGGYHPQQPPPPPQGYEPQPQYQPQGPPQYYGGPP 864 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P + P PPP P PPP PP + PPP P Sbjct: 1053 AVPIPPPRKPS-PPPSEPA--PPPRQPPPPSTSQPVPPPRQP 1091 >SB_7731| Best HMM Match : Extensin_2 (HMM E-Value=1.2) Length = 352 Score = 30.3 bits (65), Expect = 2.2 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PP PP PPG PPP PP Sbjct: 189 PPPAPPGVLPPPPAPPG--ALIPPPPAPP 215 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP P PP PPG PPP PPG Sbjct: 179 PPPAPPGVLAPPP-APPGV---LPPPPAPPG 205 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP P PPP P PP P G Sbjct: 98 PATPPPPTMPPTPPPPQTPAPPGPDTPAPPAPGG 131 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +3 Query: 795 PPEXPPXXP--PPXFXPPGXKKKXXPPPXPP 881 PP P P PP PP + PPP PP Sbjct: 246 PPSVKPSVPIPPPTKPPPRVASRRPPPPLPP 276 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPP--GXKKKXXPPPXPPGXK 890 P PPP PPP PP + PP PP K Sbjct: 258 PTKPPPRVASRRPPPPLPPPDSSEAQAQQPPLSPPVGK 295 >SB_7937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 618 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P+ G P P PP P F P G PP P G Sbjct: 393 GPGPRGMGPGMGPPRPMGPPGPHGPPFGPRGPPPHGGPPRGPMG 436 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG PP P PPP PPG P PPG Sbjct: 213 PGLMPP--PGMLPPPGGMPPGRMPPQGLPFPPPG 244 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 5/39 (12%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP---PGXKKKXXP--PPXPPG 884 P PPP P PP P PG + P PP PPG Sbjct: 1660 PAPPPPPPPAPGPPGPDGPMGLPGPQGPDGPKGPPGPPG 1698 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK PG P P+ P P PPG + PP P G Sbjct: 1686 GPDGPKGPPGPPGLPGPQGIPGYPGAPAGPPG-RDGPMGPPGPSG 1729 >SB_29025| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 2/45 (4%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPP 881 GA PK+ PPP P PPP PPP PP Sbjct: 124 GALPKKEAAASSTPPPPAKEAPLPPPPAQQEAVPDIPTSPPPVPP 168 >SB_54795| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1220 Score = 29.1 bits (62), Expect = 5.1 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPP 842 PPP PP PPP PP Sbjct: 142 PPPPPPPPSPPPPCHPP 158 >SB_18024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 29.1 bits (62), Expect = 5.1 Identities = 14/41 (34%), Positives = 17/41 (41%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPE-XPPXXPPPXFXPPGXKKKXXPPPXPP 881 P+ ++ P PPP PPP G PPP PP Sbjct: 44 PRDRERPPPPPPPRFYDNDIPPPPPPRRGFYDDYPPPPPPP 84 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPP 842 +Q + PPP PP PPP PP Sbjct: 1303 EQIQPPESPPPPPPPPPPPPPPPLPP 1328 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/42 (38%), Positives = 18/42 (42%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A K+ + P PPP PP PPP PPP PP Sbjct: 1299 ANNKEQIQPPESPPPPPPPPPPPP------------PPPLPP 1328 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 29.1 bits (62), Expect = 5.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP PP PPP P ++ PPP P G Sbjct: 511 PPPPPPASPPP---PLPAEEDNSPPPLPAG 537 >SB_23536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 24.2 bits (50), Expect(2) = 6.0 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPP 842 P PP PP PP PP Sbjct: 97 PSRGPPRGPPLPGPPRRGPP 116 Score = 23.0 bits (47), Expect(2) = 6.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 819 PPPXFXPPGXKKKXXPPP 872 PPP PP + PPP Sbjct: 133 PPPDRRPPPPDRSGYPPP 150 >SB_57668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1107 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PP PP P + PPP P Sbjct: 1016 PDPLPTDPPTEPPTDPPTPPPTEPPTPPPTEPPTPPPTDP 1055 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 28.7 bits (61), Expect = 6.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXP 866 PPP PP PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSPSRP 78 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 6.7 Identities = 14/40 (35%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXP-PXXPPPXFXPPGXKKKXXPPPXP 878 P + P P PE P P P F PP PP P Sbjct: 236 PSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPP 275 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/32 (40%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPP--PXPP 881 PPP PPP PP + PP P PP Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPP 153 Score = 28.3 bits (60), Expect = 8.9 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP P PPP P PP PP Sbjct: 133 PPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPP 165 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 28.7 bits (61), Expect = 6.7 Identities = 13/33 (39%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 783 PGXPPP-EXPPXXPPPXFXPPGXKKKXXPPPXP 878 P PPP PP PP PP + PP P Sbjct: 45 PNTPPPVTQPPVTQPPVTQPPVTQPPVTQPPPP 77 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 28.7 bits (61), Expect = 6.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPP 881 PP PPP PG + PPP PP Sbjct: 755 PPPPPPPAV--PGEGARPPPPPPPP 777 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 28.7 bits (61), Expect = 6.7 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GG P G PPP PP PPG + PPP G Sbjct: 566 GGGPPPPGAGQGGPPPPGAGQEGPP----PPGAGQGGGPPPPGAG 606 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFX-PPGXKKKXXPPPXPP 881 P +K P P P PP PP PG P PP Sbjct: 460 PPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPP 500 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 8.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP P PPP PP PPP PP Sbjct: 93 PACPPACCAPPPPPPPPPPP-----PPPPPPPP 120 >SB_45391| Best HMM Match : DUF1509 (HMM E-Value=1.9) Length = 402 Score = 28.3 bits (60), Expect = 8.9 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G Q + PG PPP PP PP + P G + + P P Sbjct: 230 GNRPTPQTEDNPG-PPPVYPP-NPPEPYSPYGRRGRKHPDADDP 271 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,440,666 Number of Sequences: 59808 Number of extensions: 187439 Number of successful extensions: 2541 Number of sequences better than 10.0: 65 Number of HSP's better than 10.0 without gapping: 509 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1706 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2574115416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -