BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O10 (897 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 37 0.033 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 37 0.033 AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-P... 37 0.033 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 37 0.033 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 37 0.033 AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p pro... 37 0.043 AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA... 37 0.043 AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB... 37 0.043 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 36 0.057 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 36 0.057 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 36 0.075 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 36 0.075 AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-P... 36 0.075 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 36 0.075 AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-P... 36 0.099 BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p pro... 35 0.13 AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p pro... 35 0.13 AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-P... 35 0.13 AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA,... 35 0.13 AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB,... 35 0.13 AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. 35 0.13 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 35 0.17 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 35 0.17 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 35 0.17 AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA... 35 0.17 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 34 0.30 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 34 0.30 AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-P... 34 0.30 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 34 0.30 AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA... 34 0.30 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 34 0.30 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 34 0.30 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 34 0.30 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 34 0.30 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 33 0.40 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 33 0.40 AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-P... 33 0.53 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 33 0.70 AY113261-1|AAM29266.1| 199|Drosophila melanogaster AT15479p pro... 33 0.70 AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 prot... 33 0.70 AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 prot... 33 0.70 AE014297-232|AAN13279.1| 199|Drosophila melanogaster CG31542-PA... 33 0.70 AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-P... 33 0.70 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 33 0.70 AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p pro... 32 0.93 AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-P... 32 0.93 AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA... 32 0.93 U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptid... 32 1.2 BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p pro... 32 1.2 AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p pro... 32 1.2 AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-P... 32 1.2 AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-P... 32 1.2 AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-P... 32 1.2 AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-P... 32 1.2 AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-P... 32 1.2 AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB... 32 1.2 BT030401-1|ABO52820.1| 451|Drosophila melanogaster FI01001p pro... 31 1.6 BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p pro... 31 1.6 AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p pro... 31 1.6 AY071031-1|AAL48653.1| 451|Drosophila melanogaster RE11345p pro... 31 1.6 AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p pro... 31 1.6 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 31 1.6 AE014298-1527|AAF47979.1| 592|Drosophila melanogaster CG2145-PA... 31 1.6 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 31 1.6 AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA... 31 1.6 AE014134-682|AAF51057.1| 451|Drosophila melanogaster CG2939-PA ... 31 1.6 AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-P... 31 1.6 BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p pro... 31 2.1 AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p pro... 31 2.1 AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC... 31 2.1 AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB... 31 2.1 AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA... 31 2.1 L02106-2|AAA99872.1| 465|Drosophila melanogaster ribonucleoprot... 31 2.8 L02106-1|AAA99873.1| 471|Drosophila melanogaster ribonucleoprot... 31 2.8 BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p pro... 31 2.8 BT010254-1|AAQ23572.1| 196|Drosophila melanogaster RE34656p pro... 31 2.8 BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p pro... 31 2.8 BT001320-1|AAN71075.1| 434|Drosophila melanogaster AT15526p pro... 31 2.8 AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p pro... 31 2.8 AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p pro... 31 2.8 AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 prot... 31 2.8 AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 p... 31 2.8 AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA... 31 2.8 AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB... 31 2.8 AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC... 31 2.8 AE014297-4014|AAX53003.1| 434|Drosophila melanogaster CG6354-PE... 31 2.8 AE014297-4013|AAX53002.1| 434|Drosophila melanogaster CG6354-PD... 31 2.8 AE014297-4012|AAX53001.1| 471|Drosophila melanogaster CG6354-PI... 31 2.8 AE014297-4011|AAX53000.1| 471|Drosophila melanogaster CG6354-PH... 31 2.8 AE014297-4010|AAX52999.1| 471|Drosophila melanogaster CG6354-PF... 31 2.8 AE014297-4009|AAF56633.1| 471|Drosophila melanogaster CG6354-PB... 31 2.8 AE014297-4008|AAX52998.1| 465|Drosophila melanogaster CG6354-PG... 31 2.8 AE014297-4007|AAX52997.1| 465|Drosophila melanogaster CG6354-PC... 31 2.8 AE014297-4006|AAN14092.1| 465|Drosophila melanogaster CG6354-PA... 31 2.8 AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC... 31 2.8 AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB... 31 2.8 AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD... 31 2.8 AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA... 31 2.8 U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. 30 3.7 BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p pro... 30 3.7 AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p pro... 30 3.7 AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p pro... 30 3.7 AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p pro... 30 3.7 AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-P... 30 3.7 AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-P... 30 3.7 AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-P... 30 3.7 AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-P... 30 3.7 AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-P... 30 3.7 BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p pro... 30 4.9 BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p pro... 30 4.9 AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p pro... 30 4.9 AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p pro... 30 4.9 AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p pro... 30 4.9 AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FB... 30 4.9 AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA ... 30 4.9 AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA... 30 4.9 AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-P... 30 4.9 X59275-1|CAA41965.1| 1603|Drosophila melanogaster posterior sex ... 29 6.5 DQ022546-1|AAZ20649.1| 907|Drosophila melanogaster truncated po... 29 6.5 DQ022543-1|AAZ20647.1| 1095|Drosophila melanogaster truncated po... 29 6.5 DQ022542-1|AAZ20646.1| 1601|Drosophila melanogaster posterior se... 29 6.5 DQ022540-1|AAZ20644.1| 1601|Drosophila melanogaster posterior se... 29 6.5 DQ022539-1|AAZ20643.1| 1095|Drosophila melanogaster truncated po... 29 6.5 DQ022538-1|AAZ20642.1| 1450|Drosophila melanogaster truncated po... 29 6.5 DQ022537-1|AAZ20641.1| 1072|Drosophila melanogaster truncated po... 29 6.5 AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p pro... 29 6.5 AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-P... 29 6.5 AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-P... 29 6.5 AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-P... 29 6.5 AE013599-1624|AAF58434.1| 1601|Drosophila melanogaster CG3886-PA... 29 6.5 AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-P... 29 8.6 AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-P... 29 8.6 AE014134-126|AAF51481.1| 795|Drosophila melanogaster CG11835-PA... 29 8.6 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 37.1 bits (82), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GGA P PG PP PPP PG PPP PPG Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPPPM---PGRAGGPPPPPPPPG 562 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 P PPP PPP P PG PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 30.3 bits (65), Expect = 3.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 750 GGAXPKQXKKXPGX-----PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 GG P PG PPP P PP PG + PP PP Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 29.1 bits (62), Expect = 8.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP P PPP PPG PPP PG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPG--MGGPPPPPMPG 573 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 37.1 bits (82), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GGA P PG PP PPP PG PPP PPG Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPPPM---PGRAGGPPPPPPPPG 562 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 P PPP PPP P PG PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 30.3 bits (65), Expect = 3.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 750 GGAXPKQXKKXPGX-----PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 GG P PG PPP P PP PG + PP PP Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 29.1 bits (62), Expect = 8.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP P PPP PPG PPP PG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPG--MGGPPPPPMPG 573 >AE014298-2543|AAF48712.2| 237|Drosophila melanogaster CG12997-PA protein. Length = 237 Score = 37.1 bits (82), Expect = 0.033 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PPP F PP PPP P Sbjct: 124 PPEPPPLFQPLEPPPLFQPPPDPPDDQPPPPSP 156 Score = 36.7 bits (81), Expect = 0.043 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPE P PPP F PP + PP PP Sbjct: 45 PPEDQPPDPPPLFQPPPEEPPDDQPPPPP 73 Score = 35.9 bits (79), Expect = 0.075 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P + P PP + PP PP F PP + PPP G Sbjct: 136 PPPLFQPPPDPPDDQPPPPSPPLFHPPDPPPEDQPPPPLEG 176 Score = 34.7 bits (76), Expect = 0.17 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPE P PPP F P PPP PP Sbjct: 119 PPEDQPPEPPPLFQPLEPPPLFQPPPDPP 147 Score = 32.7 bits (71), Expect = 0.70 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +3 Query: 768 QXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 Q + P PP+ PP PP PP + PPP PP Sbjct: 41 QAEDPPEDQPPDPPPLFQPPPEEPPDDQ----PPPPPP 74 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP P PP PP PP PP Sbjct: 133 PLEPPPLFQPPPDPPDDQPPPPSPPLFHPPDPP 165 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 37.1 bits (82), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GGA P PG PP PPP PG PPP PPG Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPPPM---PGRAGGPPPPPPPPG 562 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 P PPP PPP P PG PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 30.3 bits (65), Expect = 3.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 750 GGAXPKQXKKXPGX-----PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 GG P PG PPP P PP PG + PP PP Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 29.1 bits (62), Expect = 8.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP P PPP PPG PPP PG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPG--MGGPPPPPMPG 573 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 37.1 bits (82), Expect = 0.033 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 GGA P PG PP PPP PG PPP PPG Sbjct: 521 GGAPPPPPPPMPGRAGGGPPPPPPPPM---PGRAGGPPPPPPPPG 562 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 P PPP PPP P PG PPP PP Sbjct: 512 PMPPPPPGGGGAPPPPPPPMPGRAGGGPPPPPPP 545 Score = 30.3 bits (65), Expect = 3.7 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +3 Query: 750 GGAXPKQXKKXPGX-----PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 GG P PG PPP P PP PG + PP PP Sbjct: 537 GGPPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPPMPGMMRPGGGPPPPP 585 Score = 29.1 bits (62), Expect = 8.6 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXP--PXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP P PPP PPG PPP PG Sbjct: 540 PPPPPPPMPGRAGGPPPPPPPPG--MGGPPPPPMPG 573 >AY119485-1|AAM50139.1| 846|Drosophila melanogaster GH07623p protein. Length = 846 Score = 36.7 bits (81), Expect = 0.043 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP PP K PPP P Sbjct: 172 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 204 Score = 36.3 bits (80), Expect = 0.057 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP + PPP PP Sbjct: 152 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPP 181 Score = 35.9 bits (79), Expect = 0.075 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP PP PPP PP Sbjct: 162 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPP 191 Score = 33.5 bits (73), Expect = 0.40 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP K PPP PP Sbjct: 141 PPPAPPTLVPPPPPAPPTI--KPPPPPAPP 168 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 A P P PP PP PPP PP + PPP P Sbjct: 155 APPTIKPPPPPAPPTVEPPPPPPPA--PPTVEPPPPPPPAP 193 Score = 31.1 bits (67), Expect = 2.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKK-KXXPPPXPP 881 A PK P P E PP P P F PP + PPP PP Sbjct: 101 ASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 146 Score = 31.1 bits (67), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKKKXXPPPXP 878 P P PP PP PP P PP K PPP P Sbjct: 161 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 202 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PPP PP K + PPP PP Sbjct: 211 PPPAPTELEPPPPPAPP--KVELPPPPAPP 238 Score = 29.5 bits (63), Expect = 6.5 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPP 881 P K P PP P PP PPG + P PP P Sbjct: 87 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASP 127 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P E PP PP PPG + P PP Sbjct: 100 PASPKVEPPPPAPPGVESPPGPQPPASPRFDPP 132 Score = 29.5 bits (63), Expect = 6.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXF----XPPGXKKKXXPPPXP 878 P + PG PP P PPP PP PPP P Sbjct: 112 PPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 154 Score = 29.1 bits (62), Expect = 8.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP PP P K PPP PPG Sbjct: 89 PPKVNPPPPPRPASPKVEPPPPAPPG 114 >AE014297-4203|AAF56763.2| 1109|Drosophila melanogaster CG5514-PA, isoform A protein. Length = 1109 Score = 36.7 bits (81), Expect = 0.043 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP PP K PPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 36.3 bits (80), Expect = 0.057 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP + PPP PP Sbjct: 415 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPP 444 Score = 35.9 bits (79), Expect = 0.075 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP PP PPP PP Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 33.5 bits (73), Expect = 0.40 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP K PPP PP Sbjct: 404 PPPAPPTLVPPPPPAPPTI--KPPPPPAPP 431 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 A P P PP PP PPP PP + PPP P Sbjct: 418 APPTIKPPPPPAPPTVEPPPPPPPA--PPTVEPPPPPPPAP 456 Score = 31.1 bits (67), Expect = 2.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKK-KXXPPPXPP 881 A PK P P E PP P P F PP + PPP PP Sbjct: 364 ASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Score = 31.1 bits (67), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKKKXXPPPXP 878 P P PP PP PP P PP K PPP P Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PPP PP K + PPP PP Sbjct: 474 PPPAPTELEPPPPPAPP--KVELPPPPAPP 501 Score = 29.5 bits (63), Expect = 6.5 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPP 881 P K P PP P PP PPG + P PP P Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASP 390 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P E PP PP PPG + P PP Sbjct: 363 PASPKVEPPPPAPPGVESPPGPQPPASPRFDPP 395 Score = 29.5 bits (63), Expect = 6.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXF----XPPGXKKKXXPPPXP 878 P + PG PP P PPP PP PPP P Sbjct: 375 PPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Score = 29.1 bits (62), Expect = 8.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP PP P K PPP PPG Sbjct: 352 PPKVNPPPPPRPASPKVEPPPPAPPG 377 >AE014297-4202|AAN14134.1| 1150|Drosophila melanogaster CG5514-PB, isoform B protein. Length = 1150 Score = 36.7 bits (81), Expect = 0.043 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP PP K PPP P Sbjct: 435 PPPPPPPAPPTVEPPPPPPPAPTKVEPPPPPAP 467 Score = 36.3 bits (80), Expect = 0.057 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP + PPP PP Sbjct: 415 PPPAPPTIKPPPPPAPPTVEPPPPPPPAPP 444 Score = 35.9 bits (79), Expect = 0.075 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP PP PPP PP Sbjct: 425 PPPPAPPTVEPPPPPPPAPPTVEPPPPPPP 454 Score = 33.5 bits (73), Expect = 0.40 Identities = 15/30 (50%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP P PPP PP K PPP PP Sbjct: 404 PPPAPPTLVPPPPPAPPTI--KPPPPPAPP 431 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 A P P PP PP PPP PP + PPP P Sbjct: 418 APPTIKPPPPPAPPTVEPPPPPPPA--PPTVEPPPPPPPAP 456 Score = 31.1 bits (67), Expect = 2.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKK-KXXPPPXPP 881 A PK P P E PP P P F PP + PPP PP Sbjct: 364 ASPKVEPPPPAPPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPP 409 Score = 31.1 bits (67), Expect = 2.1 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPP---PXFXPPGXKKKXXPPPXP 878 P P PP PP PP P PP K PPP P Sbjct: 424 PPPPPAPPTVEPPPPPPPAPPTVEPPPPPPPAPTKVEPPPPP 465 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PPP PP K + PPP PP Sbjct: 474 PPPAPTELEPPPPPAPP--KVELPPPPAPP 501 Score = 29.5 bits (63), Expect = 6.5 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPP 881 P K P PP P PP PPG + P PP P Sbjct: 350 PAPPKVNPPPPPRPASPKVEPPPPAPPGVESPPGPQPPASP 390 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P E PP PP PPG + P PP Sbjct: 363 PASPKVEPPPPAPPGVESPPGPQPPASPRFDPP 395 Score = 29.5 bits (63), Expect = 6.5 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 4/43 (9%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXF----XPPGXKKKXXPPPXP 878 P + PG PP P PPP PP PPP P Sbjct: 375 PPGVESPPGPQPPASPRFDPPPPHTIEPPPPPAPPTLVPPPPP 417 Score = 29.1 bits (62), Expect = 8.6 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP PP P K PPP PPG Sbjct: 352 PPKVNPPPPPRPASPKVEPPPPAPPG 377 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 36.3 bits (80), Expect = 0.057 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PP PP + PP + PPP P Sbjct: 403 PPPTKPPTRPPTTYLPPPTVRTTRPPPPP 431 Score = 34.7 bits (76), Expect = 0.17 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP + PP + PP PP Sbjct: 846 PPPTRPPTKPPTTYLPPVTVVRTTRPPPPP 875 Score = 33.5 bits (73), Expect = 0.40 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PP PP PP + PP + PPP P Sbjct: 507 PPTKPPTRPPTTYLPPPTVRTTRPPPPP 534 Score = 33.5 bits (73), Expect = 0.40 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PP PP PP + PP + PPP P Sbjct: 615 PPTKPPTRPPTTYLPPPSVRTTRPPPPP 642 Score = 33.5 bits (73), Expect = 0.40 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PP PP PP + PP + PPP P Sbjct: 718 PPTKPPTRPPTTYLPPPTVRTTRPPPPP 745 Score = 33.5 bits (73), Expect = 0.40 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PP PP PP + PP + PPP P Sbjct: 821 PPTRPPTKPPTTYLPPPTVRTTRPPPPP 848 Score = 31.9 bits (69), Expect = 1.2 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 6/46 (13%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXK------KKXXPPPXPP 881 P + P PP PP PPP + PP K + PPP PP Sbjct: 190 PTRPPTRPPTRPPTRPP-TPPPTYLPPTNKPLPPVTTRLPPPPPPP 234 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKK--KXXPPPXPP 881 PPP PP PP + PP + + PPP P Sbjct: 429 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRP 460 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKK--KXXPPPXPP 881 PPP PP PP + PP + + PPP P Sbjct: 532 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRP 563 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKK--KXXPPPXPP 881 PPP PP PP + PP + + PPP P Sbjct: 640 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRP 671 Score = 31.1 bits (67), Expect = 2.1 Identities = 13/32 (40%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKK--KXXPPPXPP 881 PPP PP PP + PP + + PPP P Sbjct: 743 PPPTRPPTKPPTTYLPPVTVRTTRATPPPTRP 774 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/46 (32%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXK------KKXXPPPXPP 881 P P PP P PP + PP K + PPP PP Sbjct: 275 PSPRTPPPTRPPTRPPTTRPPATYLPPTNKPLPPVTTRLPPPPPPP 320 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 36.3 bits (80), Expect = 0.057 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP + PPP PP Sbjct: 463 PPPPPPPPPPPP--PPPPPTEPPPPPPPPP 490 Score = 34.3 bits (75), Expect = 0.23 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 P PPP PP PPP PP PPP P K Sbjct: 463 PPPPPPPPPPPPPPP---PPTEPPPPPPPPPEPRVK 495 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPP 842 P P PPP PP PPP PP Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPPPP 489 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 35.9 bits (79), Expect = 0.075 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P Q + P PPP+ P P P + PP + PPP P Sbjct: 70 PPQTRPPPPPPPPQPTPPAPRPSYGPP-QTQPPRPPPQP 107 Score = 35.5 bits (78), Expect = 0.099 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ P P P + PP + PP PP Sbjct: 151 PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPP 183 Score = 33.1 bits (72), Expect = 0.53 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPP-PXPP 881 P P PP+ PP PPP P PP P PP Sbjct: 135 PSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPP 175 Score = 33.1 bits (72), Expect = 0.53 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P Q K P P+ PP PP PG PPP P Sbjct: 194 PDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ P P P PP PPP PP Sbjct: 100 PPRPPPQPTPSAPAP--PPPSYGPPQTPPPRPP 130 Score = 32.3 bits (70), Expect = 0.93 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P+ P PPP P P P + PP P P P Sbjct: 199 PRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTP 237 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P G P PP PPP PP + PP P Sbjct: 58 GPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQP 100 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPP-XXPPPXFXPPGXKKKXXPPPXPP 881 A P P PPP PP P PP PPP PP Sbjct: 113 APPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPP 155 Score = 30.7 bits (66), Expect = 2.8 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPE-XPPXXPPPXFXPPGXKKKXXPPP 872 P+ P PPP PP PPP P PPP Sbjct: 105 PQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 29.9 bits (64), Expect = 4.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP P P P PP PP Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQPPRPP 104 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKK------KXXPPPXPP 881 P PP P P P + PP K + PPP PP Sbjct: 175 PAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPP 213 Score = 29.1 bits (62), Expect = 8.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP P + PP PP Sbjct: 76 PPPPPPPQPTPPAPRPSYGPPQTQPPRPPP 105 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P+ P PP PP PPP P P PP Sbjct: 131 PQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPP 170 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + + PG PP PP P P P + P P PP Sbjct: 230 PPKPQPTPGYGPP-TPPPGPGPAQPAPQPPRPQPPRPQPP 268 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 35.9 bits (79), Expect = 0.075 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXP 878 PK P PPP PP PPP PPG PP P Sbjct: 68 PKAKLPPPPPPPPPPPPPPPPPPPSPPGVPANPVSLPPQP 107 Score = 34.3 bits (75), Expect = 0.23 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P+ K PP PP PPP PP PPP PPG Sbjct: 62 PRHVGKPKAKLPPPPPPPPPPPPPPPP-------PPPSPPG 95 >AE014297-1625|AAF54898.1| 460|Drosophila melanogaster CG11670-PA protein. Length = 460 Score = 35.9 bits (79), Expect = 0.075 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 P PPP P PPP PPG PP P G Sbjct: 51 PPPPPPSPPCGRPPPGSPPPGPPPPGPPPGCPGG 84 Score = 35.5 bits (78), Expect = 0.099 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PP PPG PPP PP Sbjct: 48 PTRPPP--PPPSPPCGRPPPGSPPPGPPPPGPP 78 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP PPP P G PPP PP Sbjct: 46 PDPTRPP--PPPPSPPCGRPPPGSPPPGPP 73 Score = 30.3 bits (65), Expect = 3.7 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPP 827 P + PG PPP PP PPP Sbjct: 58 PPCGRPPPGSPPPGPPPPGPPP 79 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 35.9 bits (79), Expect = 0.075 Identities = 15/39 (38%), Positives = 19/39 (48%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P Q + P PPP+ P P P + PP + PPP P Sbjct: 70 PPQTRPPPPPPPPQPTPPAPRPSYGPP-QTQPPRPPPQP 107 Score = 35.5 bits (78), Expect = 0.099 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ P P P + PP + PP PP Sbjct: 151 PPRPPPQPTPSAPAPSYGPPQPQPPAPQPPSPP 183 Score = 33.1 bits (72), Expect = 0.53 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPP-PXPP 881 P P PP+ PP PPP P PP P PP Sbjct: 135 PSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPPQPQPP 175 Score = 33.1 bits (72), Expect = 0.53 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P Q K P P+ PP PP PG PPP P Sbjct: 194 PDQPKPRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKP 233 Score = 32.3 bits (70), Expect = 0.93 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP+ P P P PP PPP PP Sbjct: 100 PPRPPPQPTPSAPAP--PPPSYGPPQTPPPRPP 130 Score = 32.3 bits (70), Expect = 0.93 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P+ P PPP P P P + PP P P P Sbjct: 199 PRPTPSRPQPPPPPPPRPQPTPGYGPPPPPPPPKPQPTP 237 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P G P PP PPP PP + PP P Sbjct: 58 GPAPSAPAPSYGPPQTRPPPPPPPPQPTPPAPRPSYGPPQTQP 100 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/43 (37%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPP-XXPPPXFXPPGXKKKXXPPPXPP 881 A P P PPP PP P PP PPP PP Sbjct: 113 APPPPSYGPPQTPPPRPPPQPTPSAPAPPPSYGPPQTPPPRPP 155 Score = 30.7 bits (66), Expect = 2.8 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 1/38 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPE-XPPXXPPPXFXPPGXKKKXXPPP 872 P+ P PPP PP PPP P PPP Sbjct: 105 PQPTPSAPAPPPPSYGPPQTPPPRPPPQPTPSAPAPPP 142 Score = 29.9 bits (64), Expect = 4.9 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP P P P PP PP Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQPPRPP 104 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/39 (35%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKK------KXXPPPXPP 881 P PP P P P + PP K + PPP PP Sbjct: 175 PAPQPPSPPSPQPGPEYLPPDQPKPRPTPSRPQPPPPPP 213 Score = 29.1 bits (62), Expect = 8.6 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP P + PP PP Sbjct: 76 PPPPPPPQPTPPAPRPSYGPPQTQPPRPPP 105 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P+ P PP PP PPP P P PP Sbjct: 131 PQPTPSAPAPPPSYGPPQTPPPRPPPQPTPSAPAPSYGPP 170 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P + + PG PP PP P P P + P P PP Sbjct: 230 PPKPQPTPGYGPP-TPPPGPGPAQPAPQPPRPQPPRPQPP 268 >AE014296-1088|AAF50683.1| 239|Drosophila melanogaster CG12330-PA protein. Length = 239 Score = 35.5 bits (78), Expect = 0.099 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP P + PP K PPP PP Sbjct: 38 PPAPPPRPPPPAPANSYGPP-KKGNGKPPPAPP 69 >BT011463-1|AAR99121.1| 212|Drosophila melanogaster RE25907p protein. Length = 212 Score = 35.1 bits (77), Expect = 0.13 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P+ P PPP P PPP PPG PPP P Sbjct: 74 GYPPQWSPGPPAYPPPPQRPWGPPP---PPGPPPPGPPPPPGP 113 >AY113383-1|AAM29388.1| 242|Drosophila melanogaster RE04770p protein. Length = 242 Score = 35.1 bits (77), Expect = 0.13 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P+ P PPP P PPP PPG PPP P Sbjct: 104 GYPPQWSPGPPAYPPPPQRPWGPPP---PPGPPPPGPPPPPGP 143 >AE014296-1190|AAX52757.1| 1644|Drosophila melanogaster CG33556-PA protein. Length = 1644 Score = 35.1 bits (77), Expect = 0.13 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 K P PPP P PPP PP PPP PP Sbjct: 268 KTTPPPPPPPMAPAAPPP--PPPPINGAAPPPPPPP 301 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPP--XXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP PP PPP PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 >AE014296-227|AAF47476.2| 242|Drosophila melanogaster CG9184-PA, isoform A protein. Length = 242 Score = 35.1 bits (77), Expect = 0.13 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P+ P PPP P PPP PPG PPP P Sbjct: 104 GYPPQWSPGPPAYPPPPQRPWGPPP---PPGPPPPGPPPPPGP 143 >AE014296-226|AAN11471.1| 212|Drosophila melanogaster CG9184-PB, isoform B protein. Length = 212 Score = 35.1 bits (77), Expect = 0.13 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P+ P PPP P PPP PPG PPP P Sbjct: 74 GYPPQWSPGPPAYPPPPQRPWGPPP---PPGPPPPGPPPPPGP 113 >AB061681-1|BAC76439.1| 1644|Drosophila melanogaster ah1644 protein. Length = 1644 Score = 35.1 bits (77), Expect = 0.13 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 K P PPP P PPP PP PPP PP Sbjct: 268 KTTPPPPPPPMAPAAPPP--PPPPINGAAPPPPPPP 301 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPP--XXPPPXFXPPGXKKKXXPPPXPP 881 P P PPP PP PP PP PPP PP Sbjct: 273 PPPPPMAPAAPPPPPPPINGAAPPPPPPPMINGGALPPPPPP 314 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 34.7 bits (76), Expect = 0.17 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXP-----PXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP P P PPP PP PPP PP Sbjct: 477 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPP 524 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 500 PPPPPPPPPPPPPLANYG--APPPPPPPPPG 528 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 503 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 540 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 K K+ P PP PPP P PPP PP Sbjct: 471 KSAKEDGEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPP 509 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 34.7 bits (76), Expect = 0.17 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXP-----PXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP P P PPP PP PPP PP Sbjct: 572 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPP 619 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 595 PPPPPPPPPPPPPMANYG--APPPPPPPPPG 623 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 598 PPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 635 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 34.7 bits (76), Expect = 0.17 Identities = 18/48 (37%), Positives = 18/48 (37%), Gaps = 5/48 (10%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXP-----PXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP P P PPP PP PPP PP Sbjct: 705 GEKPHAVAPPPPPPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPP 752 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 728 PPPPPPPPPPPPPMANYG--APPPPPPPPPG 756 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 731 PPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPPAP 768 >AE014296-862|AAF47912.1| 707|Drosophila melanogaster CG13722-PA protein. Length = 707 Score = 34.7 bits (76), Expect = 0.17 Identities = 18/48 (37%), Positives = 20/48 (41%), Gaps = 3/48 (6%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXP---PXXPPPXFXPPGXKKKXXPPPXPPGXK 890 A P Q K+ P P P P PP + PP PPP PP K Sbjct: 167 APPPQVKQGYDYPKPAIPFPPPTAPPQKYLPPVTTTPAPPPPPPPTKK 214 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 KQ P P PP PP + PP + PPP P Sbjct: 273 KQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 310 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 KQ P P PP PP + PP + PPP P Sbjct: 535 KQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 572 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/38 (36%), Positives = 16/38 (42%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 KQ P P PP PP + PP + PPP P Sbjct: 583 KQGYDYPKPAIPFPPPTAPPQKYLPPVTTTQAPPPPPP 620 Score = 30.7 bits (66), Expect = 2.8 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 KQ P P PP PP + PP K PPP Sbjct: 319 KQGYDYPKPAIPFPPPTAPPQKYLPPVTTTKAPPPP 354 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 33.9 bits (74), Expect = 0.30 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P PG P+ PP PPP PP P P PPG Sbjct: 220 GTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYP-PPG 262 Score = 32.7 bits (71), Expect = 0.70 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 K K PG P P P PP PPG PPP PP Sbjct: 207 KGSKGPPGPPGP--PGTGPPGPPGPPGTTYPQPPPPPPP 243 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP P PP Sbjct: 152 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPP 181 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP P P PP Sbjct: 154 PPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPP 186 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP-PG 884 PPP PP PPP P PPP P PG Sbjct: 237 PPPPPPPPPPPPPSYP--YPPYPYPPPGPYPG 266 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP P PPP PP PP PPG Sbjct: 48 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPG 78 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP P PPG PP PPG Sbjct: 55 PPPPPPPPPPQHCNCPPG----PPGPPGPPG 81 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXP-PPXFXPPGXKKKXXPPPXPP 881 P PP PP P PP P PPP PP Sbjct: 215 PPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPP 248 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 33.9 bits (74), Expect = 0.30 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP PP PPP PP PPP PP Sbjct: 467 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 515 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 491 PPPPPPPPPPPPPLANYG--APPPPPPPPPG 519 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 494 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXP------PPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP PP PPP PP Sbjct: 491 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AE014298-1168|AAF46366.1| 926|Drosophila melanogaster CG10555-PA protein. Length = 926 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P ++ P P + PP PPP PP ++ PPP PP Sbjct: 540 PPGSQQVPPVPGQQQPPPGPPPPGQPPTGGQQ-QPPPGPP 578 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 P Q + PG PPP PP PPG + PP P Sbjct: 550 PGQQQPPPGPPPPGQPPTGGQQQ-PPPGPPQSQYGPPPP 587 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 33.9 bits (74), Expect = 0.30 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G P PG P+ PP PPP PP P P PPG Sbjct: 222 GTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYP-PPG 264 Score = 32.7 bits (71), Expect = 0.70 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +3 Query: 765 KQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 K K PG P P P PP PPG PPP PP Sbjct: 209 KGSKGPPGPPGP--PGTGPPGPPGPPGTTYPQPPPPPPP 245 Score = 31.9 bits (69), Expect = 1.2 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PPP PP P PP Sbjct: 154 PPPPPPPPPPPPPPPPPPHSHPHSHHPHPP 183 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP P P PP Sbjct: 156 PPPPPPPPPPPPPPPPHSHPHSHHPHPPIVTPP 188 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP-PG 884 PPP PP PPP P PPP P PG Sbjct: 239 PPPPPPPPPPPPPSYP--YPPYPYPPPGPYPG 268 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PP P PPP PP PP PPG Sbjct: 50 PPQHYYPPPPPPPPPPPQHCNCPPGPPGPPG 80 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP P PPG PP PPG Sbjct: 57 PPPPPPPPPPQHCNCPPG----PPGPPGPPG 83 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXP-PPXFXPPGXKKKXXPPPXPP 881 P PP PP P PP P PPP PP Sbjct: 217 PPGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPP 250 >AE014296-856|AAN11603.1| 440|Drosophila melanogaster CG32241-PA protein. Length = 440 Score = 33.9 bits (74), Expect = 0.30 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP + PPP + PP KK PP PP K Sbjct: 142 PPTKKVVIAPPPVYVPPPTKKVVYTPPPPPPTK 174 Score = 33.9 bits (74), Expect = 0.30 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP + PPP + PP KK PP PP K Sbjct: 255 PPTKKVVIAPPPVYVPPPTKKVIYTPPPPPPTK 287 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/30 (50%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 807 PPXXPPPXFXPPGXKK--KXXPPPXPPGXK 890 PP PPP + PP KK PPP PP K Sbjct: 381 PPPPPPPVYIPPPTKKVVVYTPPPPPPPTK 410 Score = 30.7 bits (66), Expect = 2.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXX----PPPXFXPPGXKKKXXPPPXPPGXK 890 P KK PPP P PPP PP K PPP PP K Sbjct: 157 PPPTKKVVYTPPPPPPTKKVVYTPPPP--PPTKKVVYTPPPPPPTKK 201 Score = 30.7 bits (66), Expect = 2.8 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXX----PPPXFXPPGXKKKXXPPPXPPGXK 890 P KK PPP P PPP PP K PPP PP K Sbjct: 170 PPPTKKVVYTPPPPPPTKKVVYTPPPP--PPTKKVVYTPPPPPPPPK 214 Score = 30.7 bits (66), Expect = 2.8 Identities = 14/32 (43%), Positives = 15/32 (46%), Gaps = 2/32 (6%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKK--KXXPPPXPP 881 PPP PP + PP KK PPP PP Sbjct: 355 PPPTKKVYVAPPVYVPPPTKKVVVYTPPPPPP 386 Score = 30.3 bits (65), Expect = 3.7 Identities = 19/47 (40%), Positives = 19/47 (40%), Gaps = 4/47 (8%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXX----PPPXFXPPGXKKKXXPPPXPPGXK 890 P KK PPP P PPP PP K PPP PP K Sbjct: 270 PPPTKKVIYTPPPPPPTKKVVYTPPPP--PPTKKVVYTPPPPPPPPK 314 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 33.9 bits (74), Expect = 0.30 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP PP PPP PP PPP PP Sbjct: 477 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 525 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 501 PPPPPPPPPPPPPLANYG--APPPPPPPPPG 529 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 504 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 541 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXP------PPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP PP PPP PP Sbjct: 501 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 33.9 bits (74), Expect = 0.30 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP PP PPP PP PPP PP Sbjct: 467 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 515 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 491 PPPPPPPPPPPPPLANYG--APPPPPPPPPG 519 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 494 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 531 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXP------PPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP PP PPP PP Sbjct: 491 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 33.9 bits (74), Expect = 0.30 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP PP PPP PP PPP PP Sbjct: 625 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 673 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 649 PPPPPPPPPPPPPLANYG--APPPPPPPPPG 677 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 652 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 689 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXP------PPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP PP PPP PP Sbjct: 649 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 33.9 bits (74), Expect = 0.30 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 6/49 (12%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPP------EXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P P PPP PP PPP PP PPP PP Sbjct: 572 GEKPHAVAPPPPPPPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPP 620 Score = 33.9 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PPP PP PPP G PPP PPG Sbjct: 596 PPPPPPPPPPPPPLANYG--APPPPPPPPPG 624 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = +3 Query: 783 PGXPPPEXPPXX-----PPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PPG PPP P Sbjct: 599 PPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPPAP 636 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/39 (41%), Positives = 16/39 (41%), Gaps = 6/39 (15%) Frame = +3 Query: 783 PGXPPPEXPPXXP------PPXFXPPGXKKKXXPPPXPP 881 P PPP PP P PP PP PPP PP Sbjct: 596 PPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 33.5 bits (73), Expect = 0.40 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PPP P PPP PP + PP PP Sbjct: 643 PGPPPPPEPQYLPPP---PPLANVRPLGPPPPP 672 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 33.5 bits (73), Expect = 0.40 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PPP P PPP PP + PP PP Sbjct: 643 PGPPPPPEPQYLPPP---PPLANVRPLGPPPPP 672 >AE014298-2877|AAF48974.1| 348|Drosophila melanogaster CG14218-PA protein. Length = 348 Score = 33.1 bits (72), Expect = 0.53 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PP PPP PP + + P P P Sbjct: 167 PAEPPP--PPPPPPPPTAPPRPRPRPRPRPQQP 197 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 G P P PPP PP PPP P PPP P Sbjct: 325 GQCPSPVTAAPPPPPPPPPPPPPPP---PAQTSAIPSPPPFP 363 >AY113261-1|AAM29266.1| 199|Drosophila melanogaster AT15479p protein. Length = 199 Score = 32.7 bits (71), Expect = 0.70 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXF-XPPGXKKKXXPPPXPPG 884 G PPP+ PP PPP + P + P P P G Sbjct: 18 GAPPPQQPPHRPPPSYAHQPQQQPDSCPYPGPRG 51 >AM412919-1|CAL85542.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 32.7 bits (71), Expect = 0.70 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXK--KKXXPPPXPPG 884 P PPP P PPP PPG PP PG Sbjct: 98 PPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAPG 133 >AM412917-1|CAL85540.1| 181|Drosophila melanogaster CG16743 protein protein. Length = 181 Score = 32.7 bits (71), Expect = 0.70 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXK--KKXXPPPXPPG 884 P PPP P PPP PPG PP PG Sbjct: 98 PPPPPPPHPQQAPPPSMYPPGPSGYPGGYPPQGAPG 133 >AE014297-232|AAN13279.1| 199|Drosophila melanogaster CG31542-PA protein. Length = 199 Score = 32.7 bits (71), Expect = 0.70 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXF-XPPGXKKKXXPPPXPPG 884 G PPP+ PP PPP + P + P P P G Sbjct: 18 GAPPPQQPPHRPPPSYAHQPQQQPDSCPYPGPRG 51 >AE013599-3071|AAF46625.1| 239|Drosophila melanogaster CG15225-PA protein. Length = 239 Score = 32.7 bits (71), Expect = 0.70 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PPP PP PP + PP PPP PP Sbjct: 187 PPPPPPPYYPPYPYYPP----PPPPPPLPP 212 Score = 30.3 bits (65), Expect = 3.7 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 801 EXPPXXPPPXFXPPGXKKKXXPPPXP 878 + PP PPP + PP PPP P Sbjct: 184 QYPPPPPPPPYYPPYPYYPPPPPPPP 209 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 32.7 bits (71), Expect = 0.70 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 G P P PPP PP PPP P PPP P Sbjct: 325 GQCPSPVTAAPPPPPPPPPPPPPPP---PAQTSAIPSPPPFP 363 >AY095075-1|AAM11403.1| 295|Drosophila melanogaster RE24507p protein. Length = 295 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPG-XKKKXXPPPXP 878 PK P PPP P P P + PP + K PPP P Sbjct: 147 PKVAPSLP--PPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP+ P PPP PP KK PP P K Sbjct: 199 PPKVAPSLPPPPPPPPVAPKKLYLPPAEPETK 230 Score = 30.3 bits (65), Expect = 3.7 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PK P PPP PP P + PP + PP P K Sbjct: 200 PKVAPSLP--PPPPPPPVAPKKLYLPPAEPETKYLPPSEPVEK 240 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PK P P + P P + PP PPP PP Sbjct: 121 PKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPP 160 >AE014297-3695|AAF56384.1| 208|Drosophila melanogaster CG11786-PA protein. Length = 208 Score = 32.3 bits (70), Expect = 0.93 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 PPP PPP + PP PPP P Sbjct: 83 PPPNNNYLPPPPEYGPPAGYPSYGPPPPP 111 >AE014296-853|AAF47905.2| 295|Drosophila melanogaster CG15022-PA protein. Length = 295 Score = 32.3 bits (70), Expect = 0.93 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 1/40 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPG-XKKKXXPPPXP 878 PK P PPP P P P + PP + K PPP P Sbjct: 147 PKVAPSLP--PPPPPPVVAPKPTYLPPSPPESKYLPPPTP 184 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 795 PPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PP+ P PPP PP KK PP P K Sbjct: 199 PPKVAPSLPPPPPPPPVAPKKLYLPPAEPETK 230 Score = 30.3 bits (65), Expect = 3.7 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 PK P PPP PP P + PP + PP P K Sbjct: 200 PKVAPSLP--PPPPPPPVAPKKLYLPPAEPETKYLPPSEPVEK 240 Score = 29.5 bits (63), Expect = 6.5 Identities = 13/40 (32%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PK P P + P P + PP PPP PP Sbjct: 121 PKATYLPPSKPEVKYLPPEPVAKYLPPKVAPSLPPPPPPP 160 >U21123-1|AAA85120.1| 684|Drosophila melanogaster ena polypeptide protein. Length = 684 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 401 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 430 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 443 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >BT004488-1|AAO42652.1| 687|Drosophila melanogaster LD23655p protein. Length = 687 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 404 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 433 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 446 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 481 >AY084210-1|AAL89948.1| 831|Drosophila melanogaster SD08336p protein. Length = 831 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 547 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 576 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 589 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 624 >AE013599-2829|AAM68439.1| 829|Drosophila melanogaster CG15112-PB, isoform B protein. Length = 829 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 546 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 575 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 588 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 623 >AE013599-2828|AAX52697.1| 684|Drosophila melanogaster CG15112-PE, isoform E protein. Length = 684 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 401 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 430 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 443 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2827|AAM68438.2| 684|Drosophila melanogaster CG15112-PC, isoform C protein. Length = 684 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 401 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 430 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 443 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2826|AAF57598.2| 684|Drosophila melanogaster CG15112-PA, isoform A protein. Length = 684 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 401 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 430 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 443 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 478 >AE013599-2825|AAX52696.1| 687|Drosophila melanogaster CG15112-PD, isoform D protein. Length = 687 Score = 31.9 bits (69), Expect = 1.2 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG PP PP PPP F G PPP PP Sbjct: 404 PGGPPAPAPPP-PPPSFG--GAAGGGPPPPAPP 433 Score = 29.9 bits (64), Expect = 4.9 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 3/36 (8%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPP---GXKKKXXPPPXPPG 884 G PP PP P PP G PPP PPG Sbjct: 446 GGGPPPAPPAPPAMGGGPPPAPGGPGAPPPPPPPPG 481 >AE013599-399|AAM68891.2| 409|Drosophila melanogaster CG11112-PB, isoform B protein. Length = 409 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXP 839 P + + P PPP PP PPP P Sbjct: 221 PSRPNRRPPPPPPPPPPPPPPPTLSP 246 >BT030401-1|ABO52820.1| 451|Drosophila melanogaster FI01001p protein. Length = 451 Score = 31.5 bits (68), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPP 842 PG P P+ PP PPP F P Sbjct: 348 PGPPGPQGPPGPPPPPFVAP 367 >BT011530-1|AAS15666.1| 145|Drosophila melanogaster RE20733p protein. Length = 145 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P K PPP PP PP K PP PP Sbjct: 32 APPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPP 73 Score = 30.7 bits (66), Expect = 2.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PPP PP K PPP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAP 63 >AY089614-1|AAL90352.1| 417|Drosophila melanogaster RE28792p protein. Length = 417 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP PPP P PPP PP Sbjct: 388 GYAPPPPPPCAPPP----PALSLSQPPPPPPP 415 >AY071031-1|AAL48653.1| 451|Drosophila melanogaster RE11345p protein. Length = 451 Score = 31.5 bits (68), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPP 842 PG P P+ PP PPP F P Sbjct: 348 PGPPGPQGPPGPPPPPFVAP 367 >AY060989-1|AAL28537.1| 222|Drosophila melanogaster GM14833p protein. Length = 222 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP PPP P PPP PP Sbjct: 193 GYAPPPPPPCAPPP----PALSLSQPPPPPPP 220 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 10/43 (23%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPX----------FXPPGXKKKXXPPPXPP 881 P PPP PP PPP + PP PPP PP Sbjct: 639 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 681 >AE014298-1527|AAF47979.1| 592|Drosophila melanogaster CG2145-PA protein. Length = 592 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G P Q + P P P+ PP P P P + P P P Sbjct: 221 GPRRPSQKEDFPALPAPKTPPGSPTPTPGSPSAWQSPLPTPQHP 264 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 31.5 bits (68), Expect = 1.6 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 10/43 (23%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPX----------FXPPGXKKKXXPPPXPP 881 P PPP PP PPP + PP PPP PP Sbjct: 779 PSYPPPPPPPPPPPPPQTCCAPVRPPYAPPVRPLPPPPPPPPP 821 >AE014297-2366|AAF55430.3| 787|Drosophila melanogaster CG5836-PA protein. Length = 787 Score = 31.5 bits (68), Expect = 1.6 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 786 GXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 G PP PP PPP P PPP PP Sbjct: 758 GYAPPPPPPCAPPP----PALSLSQPPPPPPP 785 >AE014134-682|AAF51057.1| 451|Drosophila melanogaster CG2939-PA protein. Length = 451 Score = 31.5 bits (68), Expect = 1.6 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPP 842 PG P P+ PP PPP F P Sbjct: 348 PGPPGPQGPPGPPPPPFVAP 367 >AE013599-2439|AAM68499.1| 145|Drosophila melanogaster CG30458-PA protein. Length = 145 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 A P K PPP PP PP K PP PP Sbjct: 32 APPAPVKSYIPPPPPPPPPAPKNTYIPPPAAPAKAYIPPPPP 73 Score = 30.7 bits (66), Expect = 2.8 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PPP PP K PPP P Sbjct: 31 PAPPAPVKSYIPPPPPPPPPAPKNTYIPPPAAP 63 >BT029607-1|ABL75666.1| 337|Drosophila melanogaster IP17050p protein. Length = 337 Score = 31.1 bits (67), Expect = 2.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG P PP PP PP PPP PP Sbjct: 209 PGAYYPPPPPFYPPYYGYPPYYPPYPYPPPPPP 241 Score = 29.5 bits (63), Expect = 6.5 Identities = 17/46 (36%), Positives = 19/46 (41%) Frame = +3 Query: 753 GAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPGXK 890 G+ P P PPP PP P + PP PPP PP K Sbjct: 204 GSGPTPGAYYP-PPPPFYPPYYGYPPYYPP--YPYPPPPPPPPTHK 246 >AY070576-1|AAL48047.1| 527|Drosophila melanogaster RE12101p protein. Length = 527 Score = 31.1 bits (67), Expect = 2.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP P PPP PP PPP PP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPP--PPPPPPAAVPPPPPPP 400 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 792 PPPEXPPXX--PPPXFXPPGXKKKXXPPPXPPG 884 PPP P PPP PP PPP P G Sbjct: 372 PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 404 >AE014297-4274|AAO41609.1| 494|Drosophila melanogaster CG1520-PC, isoform C protein. Length = 494 Score = 31.1 bits (67), Expect = 2.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP P PPP PP PPP PP Sbjct: 330 PPPISTAPPPPPVSAPVVAPPP--PPPPPPAAVPPPPPPP 367 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 792 PPPEXPPXX--PPPXFXPPGXKKKXXPPPXPPG 884 PPP P PPP PP PPP P G Sbjct: 339 PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 371 >AE014297-4273|AAN14303.1| 527|Drosophila melanogaster CG1520-PB, isoform B protein. Length = 527 Score = 31.1 bits (67), Expect = 2.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP P PPP PP PPP PP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPP--PPPPPPAAVPPPPPPP 400 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 792 PPPEXPPXX--PPPXFXPPGXKKKXXPPPXPPG 884 PPP P PPP PP PPP P G Sbjct: 372 PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 404 >AE014297-4272|AAF56819.1| 527|Drosophila melanogaster CG1520-PA, isoform A protein. Length = 527 Score = 31.1 bits (67), Expect = 2.1 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P PP P PPP PP PPP PP Sbjct: 363 PPPISTAPPPPPVSAPVVAPPP--PPPPPPAAVPPPPPPP 400 Score = 29.1 bits (62), Expect = 8.6 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 792 PPPEXPPXX--PPPXFXPPGXKKKXXPPPXPPG 884 PPP P PPP PP PPP P G Sbjct: 372 PPPVSAPVVAPPPPPPPPPAAVPPPPPPPMPVG 404 >L02106-2|AAA99872.1| 465|Drosophila melanogaster ribonucleoprotein protein. Length = 465 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >L02106-1|AAA99873.1| 471|Drosophila melanogaster ribonucleoprotein protein. Length = 471 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >BT021242-1|AAX33390.1| 1011|Drosophila melanogaster RE67944p protein. Length = 1011 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P K P PPP P PPP PP PPP Sbjct: 590 PPMLKAIPPPPPPMAPSMMPPP---PPPCPGAPPPPP 623 >BT010254-1|AAQ23572.1| 196|Drosophila melanogaster RE34656p protein. Length = 196 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 39 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 80 >BT003763-1|AAO41442.1| 652|Drosophila melanogaster RE39251p protein. Length = 652 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK G P P PP P P K PP PPG Sbjct: 509 GPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPG 553 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P PP P P P + PP PPG Sbjct: 538 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPG 573 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPPG 884 PG P P P PP PPG P PP PPG Sbjct: 555 PGPPGPTRPGPYGPP--GPPGPTGPTRPGPPGPPG 587 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + P P PG Sbjct: 580 PGPPGPPGPTRPGPPG--PPGPTRPGPPGPTRPG 611 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + PP PPG Sbjct: 569 PGPPGPTGPTRPGPPG--PPGPTRPG--PPGPPG 598 >BT001320-1|AAN71075.1| 434|Drosophila melanogaster AT15526p protein. Length = 434 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AY118439-1|AAM48468.1| 1114|Drosophila melanogaster RH61354p protein. Length = 1114 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P K P PPP P PPP PP PPP Sbjct: 551 PPMLKAIPPPPPPMAPSMMPPP---PPPCPGAPPPPP 584 >AY069625-1|AAL39770.1| 268|Drosophila melanogaster LD39545p protein. Length = 268 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK G P P PP P P K PP PPG Sbjct: 125 GPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPG 169 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P PP P P P + PP PPG Sbjct: 154 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPG 189 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPPG 884 PG P P P PP PPG P PP PPG Sbjct: 171 PGPPGPTRPGPYGPP--GPPGPTGPTRPGPPGPPG 203 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + P P PG Sbjct: 196 PGPPGPPGPTRPGPPG--PPGPTRPGPPGPTRPG 227 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + PP PPG Sbjct: 185 PGPPGPTGPTRPGPPG--PPGPTRPG--PPGPPG 214 >AM412918-1|CAL85541.1| 178|Drosophila melanogaster CG16743 protein protein. Length = 178 Score = 30.7 bits (66), Expect = 2.8 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPG 845 P PPP P PPP PPG Sbjct: 95 PPPPPPPHPQQAPPPSMYPPG 115 >AL031640-2|CAA21052.1| 979|Drosophila melanogaster EG:114D9.2 protein. Length = 979 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P K P PPP P PPP PP PPP Sbjct: 396 PPMLKAIPPPPPPMAPSMMPPP---PPPCPGAPPPPP 429 >AE014298-174|AAF45600.2| 1114|Drosophila melanogaster CG14622-PA, isoform A protein. Length = 1114 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P K P PPP P PPP PP PPP Sbjct: 551 PPMLKAIPPPPPPMAPSMMPPP---PPPCPGAPPPPP 584 >AE014298-173|AAN09040.1| 1153|Drosophila melanogaster CG14622-PB, isoform B protein. Length = 1153 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P K P PPP P PPP PP PPP Sbjct: 590 PPMLKAIPPPPPPMAPSMMPPP---PPPCPGAPPPPP 623 >AE014298-172|AAF45601.2| 1455|Drosophila melanogaster CG14622-PC, isoform C protein. Length = 1455 Score = 30.7 bits (66), Expect = 2.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPP 872 P K P PPP P PPP PP PPP Sbjct: 892 PPMLKAIPPPPPPMAPSMMPPP---PPPCPGAPPPPP 925 >AE014297-4014|AAX53003.1| 434|Drosophila melanogaster CG6354-PE, isoform E protein. Length = 434 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4013|AAX53002.1| 434|Drosophila melanogaster CG6354-PD, isoform D protein. Length = 434 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4012|AAX53001.1| 471|Drosophila melanogaster CG6354-PI, isoform I protein. Length = 471 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4011|AAX53000.1| 471|Drosophila melanogaster CG6354-PH, isoform H protein. Length = 471 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4010|AAX52999.1| 471|Drosophila melanogaster CG6354-PF, isoform F protein. Length = 471 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4009|AAF56633.1| 471|Drosophila melanogaster CG6354-PB, isoform B protein. Length = 471 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4008|AAX52998.1| 465|Drosophila melanogaster CG6354-PG, isoform G protein. Length = 465 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4007|AAX52997.1| 465|Drosophila melanogaster CG6354-PC, isoform C protein. Length = 465 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014297-4006|AAN14092.1| 465|Drosophila melanogaster CG6354-PA, isoform A protein. Length = 465 Score = 30.7 bits (66), Expect = 2.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 9/42 (21%) Frame = +3 Query: 786 GXPPPEXPPXX--PPPX-------FXPPGXKKKXXPPPXPPG 884 G PPP PP PPP + PP PPP PPG Sbjct: 277 GPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPG 318 >AE014296-964|AAN12098.1| 682|Drosophila melanogaster CG10625-PC, isoform C protein. Length = 682 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK G P P PP P P K PP PPG Sbjct: 539 GPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPG 583 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P PP P P P + PP PPG Sbjct: 568 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPG 603 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPPG 884 PG P P P PP PPG P PP PPG Sbjct: 585 PGPPGPTRPGPYGPP--GPPGPTGPTRPGPPGPPG 617 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + P P PG Sbjct: 610 PGPPGPPGPTRPGPPG--PPGPTRPGPPGPTRPG 641 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + PP PPG Sbjct: 599 PGPPGPTGPTRPGPPG--PPGPTRPG--PPGPPG 628 >AE014296-963|AAF50773.2| 682|Drosophila melanogaster CG10625-PB, isoform B protein. Length = 682 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK G P P PP P P K PP PPG Sbjct: 539 GPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPG 583 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P PP P P P + PP PPG Sbjct: 568 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPG 603 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPPG 884 PG P P P PP PPG P PP PPG Sbjct: 585 PGPPGPTRPGPYGPP--GPPGPTGPTRPGPPGPPG 617 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + P P PG Sbjct: 610 PGPPGPPGPTRPGPPG--PPGPTRPGPPGPTRPG 641 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + PP PPG Sbjct: 599 PGPPGPTGPTRPGPPG--PPGPTRPG--PPGPPG 628 >AE014296-962|AAN12097.1| 268|Drosophila melanogaster CG10625-PD, isoform D protein. Length = 268 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK G P P PP P P K PP PPG Sbjct: 125 GPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPG 169 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P PP P P P + PP PPG Sbjct: 154 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPG 189 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPPG 884 PG P P P PP PPG P PP PPG Sbjct: 171 PGPPGPTRPGPYGPP--GPPGPTGPTRPGPPGPPG 203 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + P P PG Sbjct: 196 PGPPGPPGPTRPGPPG--PPGPTRPGPPGPTRPG 227 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + PP PPG Sbjct: 185 PGPPGPTGPTRPGPPG--PPGPTRPG--PPGPPG 214 >AE014296-961|AAN12096.1| 268|Drosophila melanogaster CG10625-PA, isoform A protein. Length = 268 Score = 30.7 bits (66), Expect = 2.8 Identities = 16/45 (35%), Positives = 16/45 (35%) Frame = +3 Query: 750 GGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 G PK G P P PP P P K PP PPG Sbjct: 125 GPGGPKGPNGPNGPPGPPGPPGPPGPPGPKGPTKPGPFGPPGPPG 169 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +3 Query: 777 KXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 K P P P PP P P P + PP PPG Sbjct: 154 KGPTKPGPFGPPGPPGPPGPPGPTRPGPYGPPGPPG 189 Score = 30.3 bits (65), Expect = 3.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXP-PPXPPG 884 PG P P P PP PPG P PP PPG Sbjct: 171 PGPPGPTRPGPYGPP--GPPGPTGPTRPGPPGPPG 203 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + P P PG Sbjct: 196 PGPPGPPGPTRPGPPG--PPGPTRPGPPGPTRPG 227 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPPG 884 PG P P P PP PPG + PP PPG Sbjct: 185 PGPPGPTGPTRPGPPG--PPGPTRPG--PPGPPG 214 >U54982-2|AAC16666.1| 1262|Drosophila melanogaster stn-B protein. Length = 1262 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 783 PGXPPPEXPPXXP-PPXFXPPGXKKKXXPPP 872 P PP PP P PP PPG PPP Sbjct: 231 PIKQPPRPPPPRPAPPRPAPPGQAAPQRPPP 261 >BT011172-1|AAR88533.1| 1262|Drosophila melanogaster RH38069p protein. Length = 1262 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 783 PGXPPPEXPPXXP-PPXFXPPGXKKKXXPPP 872 P PP PP P PP PPG PPP Sbjct: 231 PIKQPPRPPPPRPAPPRPAPPGQAAPQRPPP 261 >AY119556-1|AAM50210.1| 1272|Drosophila melanogaster GH28840p protein. Length = 1272 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PP P PP P P PP Sbjct: 306 PASPSPSLPPPASPSLSLPPPASPSPSPSPPPP 338 Score = 29.5 bits (63), Expect = 6.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 5/47 (10%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEX-----PPXXPPPXFXPPGXKKKXXPPPXPP 881 A KQ P P P PP P P PP PPP P Sbjct: 283 AGRKQPPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASP 329 >AY084212-1|AAL89950.1| 1211|Drosophila melanogaster SD08909p protein. Length = 1211 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPG 845 KK PPP PP PPP PPG Sbjct: 470 KKPAAAPPPPPPPPPPPP--PPPG 491 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 795 PPEXPPXXP--PPXFXPPGXKKKXXPPPXPPG 884 PPE P P P PP PPP PPG Sbjct: 460 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 491 >AY075386-1|AAL68224.1| 1294|Drosophila melanogaster LD24110p protein. Length = 1294 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPG 845 KK PPP PP PPP PPG Sbjct: 652 KKPAAAPPPPPPPPPPPP--PPPG 673 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 795 PPEXPPXXP--PPXFXPPGXKKKXXPPPXPPG 884 PPE P P P PP PPP PPG Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 673 >AE014298-3231|ABI31012.1| 1260|Drosophila melanogaster CG12473-PB, isoform B protein. Length = 1260 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 783 PGXPPPEXPPXXP-PPXFXPPGXKKKXXPPP 872 P PP PP P PP PPG PPP Sbjct: 231 PIKQPPRPPPPRPAPPRPAPPGQAAPQRPPP 261 >AE014298-3230|EAA46059.2| 1260|Drosophila melanogaster CG12473-PA, isoform A protein. Length = 1260 Score = 30.3 bits (65), Expect = 3.7 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 783 PGXPPPEXPPXXP-PPXFXPPGXKKKXXPPP 872 P PP PP P PP PPG PPP Sbjct: 231 PIKQPPRPPPPRPAPPRPAPPGQAAPQRPPP 261 >AE014298-1554|AAF48000.3| 3539|Drosophila melanogaster CG11122-PA protein. Length = 3539 Score = 30.3 bits (65), Expect = 3.7 Identities = 12/33 (36%), Positives = 12/33 (36%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P P P PP P PP P P PP Sbjct: 2573 PASPSPSLPPPASPSLSLPPPASPSPSPSPPPP 2605 Score = 29.5 bits (63), Expect = 6.5 Identities = 16/47 (34%), Positives = 16/47 (34%), Gaps = 5/47 (10%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEX-----PPXXPPPXFXPPGXKKKXXPPPXPP 881 A KQ P P P PP P P PP PPP P Sbjct: 2550 AGRKQPPPPPASPSPSRSSSLPPPASPSPSLPPPASPSLSLPPPASP 2596 >AE014296-1521|AAF50366.2| 1294|Drosophila melanogaster CG32030-PB, isoform B protein. Length = 1294 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPG 845 KK PPP PP PPP PPG Sbjct: 652 KKPAAAPPPPPPPPPPPP--PPPG 673 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 795 PPEXPPXXP--PPXFXPPGXKKKXXPPPXPPG 884 PPE P P P PP PPP PPG Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 673 >AE014296-1520|AAF50365.2| 1393|Drosophila melanogaster CG32030-PA, isoform A protein. Length = 1393 Score = 30.3 bits (65), Expect = 3.7 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +3 Query: 774 KKXPGXPPPEXPPXXPPPXFXPPG 845 KK PPP PP PPP PPG Sbjct: 652 KKPAAAPPPPPPPPPPPP--PPPG 673 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 2/32 (6%) Frame = +3 Query: 795 PPEXPPXXP--PPXFXPPGXKKKXXPPPXPPG 884 PPE P P P PP PPP PPG Sbjct: 642 PPEPEPLSPVKKPAAAPPPPPPPPPPPPPPPG 673 >BT003654-1|AAO39658.1| 1273|Drosophila melanogaster AT04875p protein. Length = 1273 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 756 AXPKQXKKXPGXPPPEXPP-XXPPPXFXPPG 845 A P P PPP PP PPP F P G Sbjct: 704 ASPTASSAAPPPPPPPAPPAPPPPPGFSPLG 734 >BT003564-1|AAO39568.1| 468|Drosophila melanogaster LP03989p protein. Length = 468 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PPP PP K PPP P Sbjct: 182 PAPPPPAAGAPKPPP---PPPPKAAPRPPPPAP 211 >AY119164-1|AAM51024.1| 192|Drosophila melanogaster RH23514p protein. Length = 192 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXK--KKXXPPPXPPG 884 P PPP P PPP PP PP PG Sbjct: 98 PPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPG 133 >AY089515-1|AAL90253.1| 468|Drosophila melanogaster GM01350p protein. Length = 468 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PPP PP K PPP P Sbjct: 182 PAPPPPAAGAPKPPP---PPPPKAAPRPPPPAP 211 >AY060415-1|AAL25454.1| 463|Drosophila melanogaster LD37240p protein. Length = 463 Score = 29.9 bits (64), Expect = 4.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG P P+ P P P PG PP PP Sbjct: 256 PGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPP 288 >AL009195-3|CAA15702.1| 463|Drosophila melanogaster EG:30B8.5,FBgn0000810;fs(1)K10 protein. Length = 463 Score = 29.9 bits (64), Expect = 4.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG P P+ P P P PG PP PP Sbjct: 256 PGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPP 288 >AE014298-367|AAF45758.1| 463|Drosophila melanogaster CG3218-PA protein. Length = 463 Score = 29.9 bits (64), Expect = 4.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 PG P P+ P P P PG PP PP Sbjct: 256 PGGPYPQMPFPPPVPGMRGPGPMGPMGGPPPPP 288 >AE014297-1281|AAF54625.1| 468|Drosophila melanogaster CG5214-PA protein. Length = 468 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PPP PPP PP K PPP P Sbjct: 182 PAPPPPAAGAPKPPP---PPPPKAAPRPPPPAP 211 >AE014134-1996|AAF53039.1| 192|Drosophila melanogaster CG16743-PA protein. Length = 192 Score = 29.9 bits (64), Expect = 4.9 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXK--KKXXPPPXPPG 884 P PPP P PPP PP PP PG Sbjct: 98 PPPPPPPHPQQAPPPSMYPPDPSGYPGGYPPQGAPG 133 >X59275-1|CAA41965.1| 1603|Drosophila melanogaster posterior sex combs protein. Length = 1603 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 801 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 841 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P Q K PPP P PP PP K P Sbjct: 1205 PPQLPKVATPPPPSSPRVITPPKTSPPANAAKVTP 1239 >DQ022546-1|AAZ20649.1| 907|Drosophila melanogaster truncated posterior sex combs protein. Length = 907 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 >DQ022543-1|AAZ20647.1| 1095|Drosophila melanogaster truncated posterior sex combs protein. Length = 1095 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 >DQ022542-1|AAZ20646.1| 1601|Drosophila melanogaster posterior sex combs protein. Length = 1601 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P Q K PPP P PP PP K P Sbjct: 1203 PPQLPKVATPPPPSSPRVITPPKTSPPANAAKVTP 1237 >DQ022540-1|AAZ20644.1| 1601|Drosophila melanogaster posterior sex combs protein. Length = 1601 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P Q K PPP P PP PP K P Sbjct: 1203 PPQLPKVATPPPPSSPRVITPPKTSPPANAAKVTP 1237 >DQ022539-1|AAZ20643.1| 1095|Drosophila melanogaster truncated posterior sex combs protein. Length = 1095 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 >DQ022538-1|AAZ20642.1| 1450|Drosophila melanogaster truncated posterior sex combs protein. Length = 1450 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P Q K PPP P PP PP K P Sbjct: 1203 PPQLPKVATPPPPSSPRVITPPKTSPPANAAKVTP 1237 >DQ022537-1|AAZ20641.1| 1072|Drosophila melanogaster truncated posterior sex combs protein. Length = 1072 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 >AY071500-1|AAL49122.1| 514|Drosophila melanogaster RE55842p protein. Length = 514 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 PPP PP PP P P PPP PP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1038|AAF54448.2| 514|Drosophila melanogaster CG12946-PA, isoform A protein. Length = 514 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 PPP PP PP P P PPP PP Sbjct: 384 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 414 >AE014297-1037|ABI31156.1| 630|Drosophila melanogaster CG12946-PB, isoform B protein. Length = 630 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/31 (45%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 792 PPPEXPPXXPPPXFXP-PGXKKKXXPPPXPP 881 PPP PP PP P P PPP PP Sbjct: 500 PPPPAPPAGVPPAPPPMPVFGAGGAPPPPPP 530 >AE014296-2144|AAF49916.1| 733|Drosophila melanogaster CG10663-PA protein. Length = 733 Score = 29.5 bits (63), Expect = 6.5 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXPP 881 P PP PP PPP P PPP PP Sbjct: 175 PAAHPPTQPPTYPPPTHPP-------TPPPTPP 200 >AE013599-1624|AAF58434.1| 1601|Drosophila melanogaster CG3886-PA protein. Length = 1601 Score = 29.5 bits (63), Expect = 6.5 Identities = 18/46 (39%), Positives = 19/46 (41%) Frame = +3 Query: 741 NXXGGAXPKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXPPPXP 878 N G A PK K P PPP PP P P + PPP P Sbjct: 799 NSSGTASPKIEK--PLMPPPAKPPMLAPRKLQP---SAQFAPPPSP 839 Score = 29.1 bits (62), Expect = 8.6 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPPGXKKKXXP 866 P Q K PPP P PP PP K P Sbjct: 1203 PPQLPKVATPPPPSSPRVITPPKTSPPANAAKVTP 1237 >AE014296-2355|AAF49762.2| 1155|Drosophila melanogaster CG32138-PB, isoform B protein. Length = 1155 Score = 29.1 bits (62), Expect = 8.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPG 845 P PPP P PPP F P G Sbjct: 606 PPPPPPAPPAPPPPPGFSPLG 626 >AE014296-2354|AAF49761.2| 1165|Drosophila melanogaster CG32138-PA, isoform A protein. Length = 1165 Score = 29.1 bits (62), Expect = 8.6 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 783 PGXPPPEXPPXXPPPXFXPPG 845 P PPP P PPP F P G Sbjct: 606 PPPPPPAPPAPPPPPGFSPLG 626 >AE014134-126|AAF51481.1| 795|Drosophila melanogaster CG11835-PA protein. Length = 795 Score = 29.1 bits (62), Expect = 8.6 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Frame = +3 Query: 762 PKQXKKXPGXPPPEXPPXXPPPXFXPP-GXKKKXXPPPXPP 881 PKQ P E PP P PP G K+ PP P Sbjct: 436 PKQGSPPKNVPKQESPPQSAPKQDSPPKGAPKQDSPPKGAP 476 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,553,303 Number of Sequences: 53049 Number of extensions: 465844 Number of successful extensions: 6224 Number of sequences better than 10.0: 133 Number of HSP's better than 10.0 without gapping: 1583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4454 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4362070239 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -