BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O09 (902 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q92845 Cluster: Kinesin-associated protein 3; n=42; Deu... 35 2.5 UniRef50_Q7RE41 Cluster: Arabinogalactan protein; n=4; Plasmodiu... 33 7.5 >UniRef50_Q92845 Cluster: Kinesin-associated protein 3; n=42; Deuterostomia|Rep: Kinesin-associated protein 3 - Homo sapiens (Human) Length = 792 Score = 35.1 bits (77), Expect = 2.5 Identities = 12/23 (52%), Positives = 21/23 (91%) Frame = +1 Query: 271 VAVLHHVDDYVELLYDDIPEKIK 339 VA ++ +D+Y+ELLY+DIP+K++ Sbjct: 129 VANINDMDEYIELLYEDIPDKVR 151 >UniRef50_Q7RE41 Cluster: Arabinogalactan protein; n=4; Plasmodium|Rep: Arabinogalactan protein - Plasmodium yoelii yoelii Length = 447 Score = 33.5 bits (73), Expect = 7.5 Identities = 14/54 (25%), Positives = 29/54 (53%) Frame = +3 Query: 9 YYRPHYREFLRFAFRDRFLGIRQHSSCRYLLTPWVRIHCKIGIVFEFYYYLIFI 170 Y +Y + LR++++ +FL I +++ + + HCK +VFE + F+ Sbjct: 341 YLSKNYNQILRYSYKGKFLYIYKYTKNQLKGKNMICSHCKSKLVFELQLFSTFV 394 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,827,895 Number of Sequences: 1657284 Number of extensions: 7658851 Number of successful extensions: 14368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13924 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14344 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 81981722200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -