BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O09 (902 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 26 0.54 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 6.7 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 25.8 bits (54), Expect = 0.54 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 1/39 (2%) Frame = +3 Query: 57 RFLGIRQHSSCRYLLTP-WVRIHCKIGIVFEFYYYLIFI 170 R LG RQ S +L T + R+ C+I V YYLI I Sbjct: 189 RVLGHRQRHSTIHLSTGNYSRLACEIQFVRSMGYYLIQI 227 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 6.7 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -3 Query: 93 TYNWSAV*CREIGLEKQILRIP 28 T+N +AV C +G+E+ RIP Sbjct: 772 TWNTNAVDCSGLGVEEIPRRIP 793 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,368 Number of Sequences: 438 Number of extensions: 3348 Number of successful extensions: 36 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -