BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O07 (891 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE... 55 3e-06 UniRef50_Q6UUU1 Cluster: Putative uncharacterized protein; n=1; ... 50 8e-05 UniRef50_P03087 Cluster: Capsid protein VP1; n=1927; Polyomaviru... 45 0.002 UniRef50_P03023 Cluster: Lactose operon repressor; n=24; Enterob... 40 0.085 UniRef50_A0ST23 Cluster: Putative reverse transcriptase; n=4; Ma... 38 0.26 UniRef50_O69419 Cluster: Putative uncharacterized protein; n=3; ... 38 0.45 UniRef50_A2SSD8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.6 UniRef50_A6DNS7 Cluster: Probable ECF sigma factor; n=1; Lentisp... 33 7.4 UniRef50_Q8GUF1 Cluster: Reverse transcriptase; n=1; Cicer ariet... 33 7.4 >UniRef50_Q9KHC4 Cluster: SocE; n=1; Myxococcus xanthus|Rep: SocE - Myxococcus xanthus Length = 486 Score = 54.8 bits (126), Expect = 3e-06 Identities = 31/54 (57%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +2 Query: 344 CINESANARGEAVCVLGALPLPRSLTRCXRSFGCGERYXL-TQRR*YGYPQNQG 502 CI + A AR EAV VL ALPL RS TRC RS GCG + R YG PQ QG Sbjct: 266 CIRDPATARSEAVWVLVALPLLRSRTRCVRSVGCGGAVSAHSPGRPYGDPQPQG 319 >UniRef50_Q6UUU1 Cluster: Putative uncharacterized protein; n=1; Escherichia coli|Rep: Putative uncharacterized protein - Escherichia coli Length = 147 Score = 50.0 bits (114), Expect = 8e-05 Identities = 22/33 (66%), Positives = 24/33 (72%) Frame = +2 Query: 368 RGEAVCVLGALPLPRSLTRCXRSFGCGERYXLT 466 R +C G +PLPRSLTR RSFGCGERY LT Sbjct: 26 RVSRICDTGDIPLPRSLTRYARSFGCGERYRLT 58 >UniRef50_P03087 Cluster: Capsid protein VP1; n=1927; Polyomavirus|Rep: Capsid protein VP1 - Simian virus 40 (SV40) Length = 364 Score = 45.2 bits (102), Expect = 0.002 Identities = 19/19 (100%), Positives = 19/19 (100%) Frame = +3 Query: 147 DPDMIRYIDEFGQTTTRMQ 203 DPDMIRYIDEFGQTTTRMQ Sbjct: 346 DPDMIRYIDEFGQTTTRMQ 364 >UniRef50_P03023 Cluster: Lactose operon repressor; n=24; Enterobacteriaceae|Rep: Lactose operon repressor - Escherichia coli (strain K12) Length = 360 Score = 39.9 bits (89), Expect = 0.085 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -1 Query: 414 ERGSGRAPNTQTASPRALADSLMQ 343 +R + APNTQTASPRALADSLMQ Sbjct: 325 KRKTTLAPNTQTASPRALADSLMQ 348 >UniRef50_A0ST23 Cluster: Putative reverse transcriptase; n=4; Magnoliophyta|Rep: Putative reverse transcriptase - Zingiber officinale (Ginger) Length = 49 Score = 38.3 bits (85), Expect = 0.26 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +3 Query: 342 SALMNXPTRGERRFAYW 392 +ALMN PTRGERRFAYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >UniRef50_O69419 Cluster: Putative uncharacterized protein; n=3; root|Rep: Putative uncharacterized protein - Escherichia coli Length = 61 Score = 37.5 bits (83), Expect = 0.45 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 502 PLILWITVLPPLSEXIPL 449 PLILWITVLPPLSE PL Sbjct: 33 PLILWITVLPPLSELTPL 50 >UniRef50_A2SSD8 Cluster: Putative uncharacterized protein; n=1; Methanocorpusculum labreanum Z|Rep: Putative uncharacterized protein - Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) Length = 109 Score = 33.9 bits (74), Expect = 5.6 Identities = 21/55 (38%), Positives = 28/55 (50%) Frame = -2 Query: 305 KMNAIVVVNLFIAAYNGYK*SNSITNFTNKAFFSLHSSCGLSKLINVSYHVWIQL 141 +MNA V + FIAA + +T + AFF L S G ++VSY VW L Sbjct: 27 RMNAWVDLAAFIAAV-----ATCVTGYVLWAFFPLGSGRGAMNFLDVSYQVWYDL 76 >UniRef50_A6DNS7 Cluster: Probable ECF sigma factor; n=1; Lentisphaera araneosa HTCC2155|Rep: Probable ECF sigma factor - Lentisphaera araneosa HTCC2155 Length = 201 Score = 33.5 bits (73), Expect = 7.4 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +3 Query: 225 EICDAIALFVTIISCNKQVNNNNCIHFMFQVQGEVWEVFSALMNXPTRGERRFAYW 392 + DA F+ I N +N+++C + +V +VWE + P RG +F YW Sbjct: 32 DFSDAYRRFIYIALRNNGLNHHDCEEVVQRVMIKVWEKIARFKYNPGRG--KFRYW 85 >UniRef50_Q8GUF1 Cluster: Reverse transcriptase; n=1; Cicer arietinum|Rep: Reverse transcriptase - Cicer arietinum (Chickpea) (Garbanzo) Length = 37 Score = 33.5 bits (73), Expect = 7.4 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 477 NTVIHRIRGITQERTCE 527 NTVIH +GITQERTCE Sbjct: 21 NTVIHXNQGITQERTCE 37 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,884,273 Number of Sequences: 1657284 Number of extensions: 8922232 Number of successful extensions: 20135 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 19013 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20113 length of database: 575,637,011 effective HSP length: 100 effective length of database: 409,908,611 effective search space used: 80342087756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -