BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O05 (869 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 29 0.14 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 28 0.32 AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-spe... 28 0.32 AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cut... 28 0.32 AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-spe... 28 0.43 AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-spe... 28 0.43 AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-spe... 28 0.43 AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-spe... 28 0.43 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 28 0.43 AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-spe... 28 0.43 AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-spe... 27 0.56 EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein A... 26 1.3 AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-spe... 26 1.7 AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-spe... 26 1.7 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 29.5 bits (63), Expect = 0.14 Identities = 12/38 (31%), Positives = 15/38 (39%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 +HH P H+ HH H+ HH P HH Sbjct: 174 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHH 211 Score = 27.1 bits (57), Expect = 0.74 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = -3 Query: 330 HHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 H+ P HH H+ HH HH P H T Sbjct: 182 HYSAPIAHHAAPIAHYAAPIAHHAAPIAHHAAPIAHST 219 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 169 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 204 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 28.3 bits (60), Expect = 0.32 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 178 HHHAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHST 216 Score = 25.0 bits (52), Expect = 3.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 173 HATVQHHHAAPIAHYAAPIAHHAAPIAHYAAPIAHH 208 >AF043438-1|AAC05663.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 28.3 bits (60), Expect = 0.32 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 178 HHHAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHST 216 Score = 25.0 bits (52), Expect = 3.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 173 HATVQHHHAAPIAHYAAPIAHHAAPIAHYAAPIAHH 208 >AF043435-1|AAC05660.1| 231|Anopheles gambiae pupal-specific cuticular protein CP2b protein. Length = 231 Score = 28.3 bits (60), Expect = 0.32 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 178 HHHAAPIAHYAAPIAHHAAPIAHYAAPIAHHAAPIAHST 216 Score = 25.0 bits (52), Expect = 3.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 173 HATVQHHHAAPIAHYAAPIAHHAAPIAHYAAPIAHH 208 >AF043442-1|AAC05667.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 231 Score = 27.9 bits (59), Expect = 0.43 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 178 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 216 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 173 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 208 >AF043439-1|AAC05664.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.9 bits (59), Expect = 0.43 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 186 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 224 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 181 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043437-1|AAC05662.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 239 Score = 27.9 bits (59), Expect = 0.43 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 186 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 224 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 181 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043436-1|AAC05661.1| 263|Anopheles gambiae putative pupal-specific cuticular proteinCP2c protein. Length = 263 Score = 27.9 bits (59), Expect = 0.43 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 210 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 248 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 205 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 240 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.9 bits (59), Expect = 0.43 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 178 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 216 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 173 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 208 >AF043433-2|AAC05657.1| 239|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 239 Score = 27.9 bits (59), Expect = 0.43 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 186 HHHAAPIAHYSAPIAHHAAPIAHYAAPIAHHAAPIAHST 224 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 181 HATVQHHHAAPIAHYSAPIAHHAAPIAHYAAPIAHH 216 >AF043433-1|AAC05656.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 27.5 bits (58), Expect = 0.56 Identities = 12/39 (30%), Positives = 15/39 (38%) Frame = -3 Query: 333 YHHIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 +HH P H+ HH H+ HH P H T Sbjct: 178 HHHAAPIAHYSAPIAHHAAPITHYAAPIAHHAAPIAHST 216 Score = 24.6 bits (51), Expect = 4.0 Identities = 10/36 (27%), Positives = 13/36 (36%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 H +HH H+ HH H+ P HH Sbjct: 173 HATVQHHHAAPIAHYSAPIAHHAAPITHYAAPIAHH 208 >EF427621-5|ABO09853.1| 62|Anopheles gambiae tal-like protein AA protein. Length = 62 Score = 26.2 bits (55), Expect = 1.3 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = -3 Query: 318 PDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHH 220 P +HH + +H R+ HH + H ++ CH+ Sbjct: 25 PFHHHHQQQQNHQRMPHHHQQQQQHQVK--CHY 55 Score = 24.6 bits (51), Expect = 4.0 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = -3 Query: 366 SGLGCHQIRXGYHHIRPDYHHIRXDCHHIRLDCHHIRLDY 247 SG Q +HH + +H R HH + H ++ Y Sbjct: 16 SGASSSQRSPFHHHHQQQQNHQRMPHHHQQQQQHQVKCHY 55 >AF043443-1|AAC05668.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/37 (29%), Positives = 13/37 (35%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 H +HH H+ HH HH P H T Sbjct: 181 HATVQHHHAAPIAHYAAPIAHHAAPIAHHAAPIAHST 217 >AF043434-1|AAC05659.1| 232|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 232 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/37 (29%), Positives = 13/37 (35%) Frame = -3 Query: 327 HIRPDYHHIRXDCHHIRLDCHHIRLDYHHIRPDCHHT 217 H +HH H+ HH HH P H T Sbjct: 181 HATVQHHHAAPIAHYAAPIAHHAAPIAHHAAPIAHST 217 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 436,379 Number of Sequences: 2352 Number of extensions: 5627 Number of successful extensions: 44 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 93026475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -