BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O03 (855 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 25 1.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 25 1.2 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 25 1.2 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 6.3 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 24.6 bits (51), Expect = 1.2 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 558 NCIWNGIRTTPLAKICSYKNESKCDLSLEPEITEIFSTS-QDP 683 N + G T KI Y E+ + P EIFSTS +DP Sbjct: 374 NTEFYGSIDTLARKILGYNLEAASKYQIVPSALEIFSTSMKDP 416 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 24.6 bits (51), Expect = 1.2 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +3 Query: 558 NCIWNGIRTTPLAKICSYKNESKCDLSLEPEITEIFSTS-QDP 683 N + G T KI Y E+ + P EIFSTS +DP Sbjct: 374 NTEFYGSIDTLARKILGYNLEAASKYQIVPSALEIFSTSMKDP 416 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 24.6 bits (51), Expect = 1.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -3 Query: 166 Y*LGAGQKLH*CFFFVGLNSRCSGVIRNIRQP 71 Y LG G H C + + ++S C G+++ + P Sbjct: 35 YCLGCGDSCHKCKYGIAMSSAC-GIVQCAKGP 65 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/9 (66%), Positives = 8/9 (88%) Frame = +3 Query: 561 CIWNGIRTT 587 CIW G++TT Sbjct: 190 CIWKGVKTT 198 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,996 Number of Sequences: 438 Number of extensions: 3493 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -