BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O01 (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 45 1e-04 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 39 0.005 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.045 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 36 0.045 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 36 0.059 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 34 0.18 SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 33 0.32 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 33 0.32 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 33 0.32 SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) 30 0.52 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 31 0.96 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 31 0.96 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 31 0.96 SB_812| Best HMM Match : FH2 (HMM E-Value=0) 31 0.96 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 31 1.7 SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 31 1.7 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) 30 2.9 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 30 2.9 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.9 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 30 2.9 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 29 5.1 SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) 29 5.1 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 29 6.8 SB_13198| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) 29 6.8 SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) 29 6.8 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 28 9.0 SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) 28 9.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 28 9.0 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 44.8 bits (101), Expect = 1e-04 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PPPP PAP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 42.7 bits (96), Expect = 4e-04 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P P PPPP P P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPP 430 Query: 668 XP 673 P Sbjct: 431 PP 432 Score = 41.9 bits (94), Expect = 7e-04 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P P PPPP P P Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPP-----PPPPPPPPPPPPPPPPPPPPAPPPP 423 Query: 668 XPXP 679 P P Sbjct: 424 PPPP 427 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PPPP P P P P Sbjct: 366 PPPPPPPPPPPSPPPPPPPP--PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA 664 PP PPP PP P P P P P P PPPP PA Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPA 433 Score = 35.1 bits (77), Expect = 0.078 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP P PPPP P PPPA PP Sbjct: 369 PPPPPPPPSPPPPPPPPPPSPPPPPQPPPPP-PPPPPPPPPPPPPPPPPPPAPPPPPPPP 427 Query: 700 P 702 P Sbjct: 428 P 428 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/80 (25%), Positives = 20/80 (25%) Frame = +1 Query: 523 PPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXXP 702 PPPPP P PPPP P PPP PP P Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Query: 703 XXXXXXXXXXXXXXXPPAAR 762 PP R Sbjct: 425 PPPPPPPPALRLACAPPRLR 444 Score = 31.9 bits (69), Expect = 0.73 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 +PPPP P PPP+ PP P Sbjct: 364 SPPPPPPPPPPPPSPPPPPPPPP 386 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +1 Query: 640 PPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXP 777 PPP P PPP PP P PPA R P Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPPPPPPPPALRLACAP 440 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXP 777 PP P P PPP PP P PP A P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPP 421 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 41.5 bits (93), Expect = 0.001 Identities = 21/60 (35%), Positives = 21/60 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP PG AP G P P P P PPPP P P Sbjct: 935 PPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPPPP 994 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/54 (40%), Positives = 22/54 (40%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP PG APL P P P P PPPP P P P Sbjct: 920 PPPPPP--------PGGNAPL------PPPPP-GGSAPSQPPPPGGNAPPPPPP 958 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP--GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP PPPPP P G P P P P PPP P Sbjct: 923 PPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAP 982 Query: 662 APXPXP 679 P P P Sbjct: 983 PPPPPP 988 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/52 (34%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 518 PPPPPPXXXXXXXXP--GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPPPP P G AP P P P PPP P P Sbjct: 921 PPPPPPGGNAPLPPPPPGGSAP------SQPPPPGGNAPPPPPPPGGSAPPP 966 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/62 (27%), Positives = 17/62 (27%), Gaps = 2/62 (3%) Frame = +1 Query: 523 PPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPP--PPXXXPXPPPAXPPXXXX 696 PPPPP P S PP PP PPP PP Sbjct: 933 PPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPPPPPPPP 992 Query: 697 XP 702 P Sbjct: 993 PP 994 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 39.1 bits (87), Expect = 0.005 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP + PPPPP P AP P P PPPP P P Sbjct: 317 PPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPP 376 Query: 668 XPXP 679 P P Sbjct: 377 PPPP 380 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +2 Query: 521 PPPPPXXXXXXXXP--GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P GA P G P P P PPPP P P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPP 341 Score = 31.5 bits (68), Expect = 0.96 Identities = 24/78 (30%), Positives = 26/78 (33%), Gaps = 14/78 (17%) Frame = +2 Query: 488 PPKKKXXXXXPP----PPPPXXXXXXXXPGAXAPLFXX-----GXXPXPXPFXXKXPXX- 637 PP + PP PPPP G AP G P P P + P Sbjct: 330 PPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSL 389 Query: 638 ----PPPPXXXPAPXPXP 679 PPPP AP P P Sbjct: 390 GNPPPPPPPGRGAPPPGP 407 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/60 (28%), Positives = 17/60 (28%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP G P P P P P PPPP P Sbjct: 327 PPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPP 386 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP PPPP PPP PP Sbjct: 326 PPPPPPSRSSQRPPPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRP 385 Query: 700 P 702 P Sbjct: 386 P 386 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 37.1 bits (82), Expect = 0.019 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PP PPP P A P P P P P PPPP P Sbjct: 175 PPPPYPPPPNPPYPPPPNPPYPPPPNAPNP--PPPNPPYPPPPNAPNPPYPPPPNAPNPP 232 Query: 668 XPXP 679 P P Sbjct: 233 YPPP 236 Score = 35.5 bits (78), Expect = 0.059 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP P PP P P AP P P P P PPP P P Sbjct: 118 PPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYP-P 176 Query: 668 XPXP 679 P P Sbjct: 177 PPYP 180 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/53 (35%), Positives = 19/53 (35%), Gaps = 1/53 (1%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP-PPPXXXPAPXP 673 PP PPP P AP P P P P P PPP P P P Sbjct: 154 PPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPP 206 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP-- 661 PP PP PP P P P P P P P PP P Sbjct: 141 PPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPN 200 Query: 662 APXPXP 679 AP P P Sbjct: 201 APNPPP 206 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PP P P PL+ P P P PPPP P Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Query: 668 XPXP 679 P P Sbjct: 190 PPNP 193 Score = 32.3 bits (70), Expect = 0.55 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PP PPP P P P P P P PPPP P Sbjct: 167 PPPPNAPYPPPPYPPPPNPPYPPPPNPPYP--PPPNAPNPPP---PNPPYPPPPNAPNPP 221 Query: 668 XPXP 679 P P Sbjct: 222 YPPP 225 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/56 (33%), Positives = 19/56 (33%), Gaps = 4/56 (7%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP----PPPXXXPAPXP 673 PPPP P P AP P P P P P PPP P P P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPP 159 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/53 (33%), Positives = 18/53 (33%), Gaps = 1/53 (1%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP-PPPXXXPAPXP 673 PPPP P P P P P P P P PPP P P P Sbjct: 162 PPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPP 214 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/77 (23%), Positives = 19/77 (24%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXPXXXXXXXXXXXXX 816 PPPP P PP PP P PP+ P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 817 XXXXXPXXPPXXPXPXP 867 P P P P P Sbjct: 164 PPNPPPPNAPYPPPPYP 180 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/64 (28%), Positives = 18/64 (28%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP P P P P P P P PP P Sbjct: 157 PPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPN 216 Query: 668 XPXP 679 P P Sbjct: 217 APNP 220 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP--PPPXXXP 661 PP PP PPP P P P P P PPP P Sbjct: 104 PPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPP 163 Query: 662 APXPXP 679 P P P Sbjct: 164 PPNPPP 169 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPP PP P P P P P P PPPP P P Sbjct: 96 PPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPP---PNPPYPPPPNAPYPPSP 144 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPP P P PPP P PPP PP Sbjct: 109 PPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPP 168 Query: 700 P 702 P Sbjct: 169 P 169 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXP--PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP P P PPP P A P P P P PPPP P Sbjct: 110 PPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPN--P 167 Query: 662 APXPXP 679 P P Sbjct: 168 PPPNAP 173 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PPPP P P P P Sbjct: 365 PPPPPPTNKPPPPPPPTNGP-------PPPPP-PTNGPPPPPPPTNGPPPPPPP 410 Score = 35.9 bits (79), Expect = 0.045 Identities = 19/55 (34%), Positives = 19/55 (34%), Gaps = 1/55 (1%) Frame = +2 Query: 518 PPPPPPXXXXXXXXP-GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P P P P P P PPPP P P P P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPP 400 Score = 31.5 bits (68), Expect = 0.96 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA 664 PP PPPPPP P P P P P P PPP P+ Sbjct: 365 PPPPPPTNKPPPPPPPTNGPPPPPPPTNGP-------PPPPPPTNGPPPPPPPTNGPPS 416 Score = 29.1 bits (62), Expect = 5.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 TPPPP PPP PP P Sbjct: 364 TPPPPPPTNKPPPPPPPTNGPPP 386 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 35.9 bits (79), Expect = 0.045 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP-FXXKXPXXPPPPXXXP 661 PP K P PPPP P G P P P F P PPPP P Sbjct: 388 PPWSKPGGILPGPPPPGPPMLNMAPSIPPWQTTPGYIPPPPPGFPQFQPPPPPPPSDAP 446 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 35.9 bits (79), Expect = 0.045 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPP 646 PPPPPP P PL P P P P PPP Sbjct: 663 PPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 35.1 bits (77), Expect = 0.078 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PPPPPP P P G P P P PPPP Sbjct: 662 PPPPPPPGGQAGGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPPP 705 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP PG A P P P PPPP AP P P Sbjct: 660 PPPPPPPP------PGGQA---GGAPPPPPPPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 35.5 bits (78), Expect = 0.059 Identities = 21/68 (30%), Positives = 22/68 (32%), Gaps = 4/68 (5%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXP-XPFXXKXPXXP---PPPXX 655 PP PPPPP P P+ P P P P P PPP Sbjct: 140 PPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPP 199 Query: 656 XPAPXPXP 679 P P P P Sbjct: 200 PPPPPPPP 207 Score = 35.1 bits (77), Expect = 0.078 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPX---PXPFXXKXPXXPPPPXXX 658 PP PPPPP P PL P P P P PPPP Sbjct: 153 PPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPPPPPPPPPPPPILE 212 Query: 659 PAPXPXP 679 A P P Sbjct: 213 LAAPPPP 219 Score = 34.7 bits (76), Expect = 0.10 Identities = 22/69 (31%), Positives = 23/69 (33%), Gaps = 5/69 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPX-PFXXKXPXXP----PPPX 652 PP PPPPPP P P+ P P P P P PPP Sbjct: 141 PPPIAPATGGPPPPPPIAPATGGPP-PPPPIAPAATVPAPAVPLAAASPPPPSGGPPPPP 199 Query: 653 XXPAPXPXP 679 P P P P Sbjct: 200 PPPPPPPPP 208 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 1/50 (2%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLF-XXGXXPXPXPFXXKXPXXPPPPXXXPA 664 P PPPP P P+ G P P P PPPP PA Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPA 173 Score = 33.1 bits (72), Expect = 0.32 Identities = 18/61 (29%), Positives = 19/61 (31%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP P +PPPP P PPP PP Sbjct: 151 PPPPPPIAPATGGPPPPPPIAPAATVPAPA--VPLAAASPPPPSGGPPPPPPPPPPPPPP 208 Query: 700 P 702 P Sbjct: 209 P 209 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPP P P+ P P P P P A Sbjct: 127 PPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAPAATVPAPAVPLAAA 186 Query: 668 XPXP 679 P P Sbjct: 187 SPPP 190 Score = 30.3 bits (65), Expect = 2.2 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 5/59 (8%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXG--XXPXPXPFXXKXPXXPPPPXXXPA---PXPXP 679 PPPPP P P P P P PPPP PA P P P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPP 168 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 35.1 bits (77), Expect = 0.078 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP+K P PPP P P+ P P P P PPP P P Sbjct: 1058 PPRKPSPPPSEPAPPPRQPPP---PSTSQPV-PPPRQPDPIPTNPAHPTEPPPRQPKPTP 1113 Query: 668 XPXP 679 P P Sbjct: 1114 APRP 1117 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/64 (29%), Positives = 22/64 (34%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPK+K P PP P + P+ P P P P PPP P Sbjct: 1028 PPKRKASPPSAQPLPPPRKPSP--PPSAVPI-PPPRKPSPPPSEPAPPPRQPPPPSTSQP 1084 Query: 668 XPXP 679 P P Sbjct: 1085 VPPP 1088 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.3 bits (75), Expect = 0.14 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P A P P P P PPPP PAP P P Sbjct: 51 PPPPPS---PPAAAPAAPPP---PAAAPAAPPPPAAPPAAPPPPPPLPAPPPPP 98 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP P A P P P P PPPP PAP Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPP----AAPPPPPPL-----PAPPPPPAQPAP 103 Query: 668 XPXP 679 P P Sbjct: 104 QPPP 107 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXX--GXXPXPXPFXXKXPXXPPPPX-XXPAPXPXP 679 PPP PP P A AP P P P PPPP P P P P Sbjct: 53 PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAP 109 Score = 31.5 bits (68), Expect = 0.96 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXP 681 PPPPPP P + PPPP P PPPA P Sbjct: 50 PPPPPPSPPAAAPAAPPPPAAAPAAPPPPAA--PPAAPPPPPPLPAPPPPPAQP 101 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 1/36 (2%) Frame = +2 Query: 575 PLFXXGXXPXPXPF-XXKXPXXPPPPXXXPAPXPXP 679 P F P P P P PPPP PA P P Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPP 78 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/57 (33%), Positives = 19/57 (33%) Frame = +2 Query: 497 KKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 KK PPPPPP P P G P P P P P P P P Sbjct: 771 KKALGAPPPPPPPTKPATPRVP-PNIPSRPPGARPTPPPPPPGKPTKPTKPSLPPVP 826 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/53 (37%), Positives = 20/53 (37%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P P G P P P P PPPP AP P P Sbjct: 292 PPPPPADGSAPAPPPPPPP----GGAPPPPP-----PPPPPPPGDGGAPPPPP 335 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PP PPPPPP PG P P P P P PPPP Sbjct: 294 PPPADGSAPAPPPPPP--------PGGAPP--PPPPPPPPPPGDGGAPPPPPPP 337 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 307 PPPPGGAPPPPPPPPP 322 >SB_56047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 440 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPPPP P P P P P P PPPP P Sbjct: 280 PPPPPPLTGGMLPPPFGGHP--AAAPPPPPLPAGVPAPPPPPPPPMLGGP 327 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P A L P P P PPPP P Sbjct: 702 PPLLSGTLPMPPPPPP-------PPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLP 754 Query: 668 XPXP 679 P P Sbjct: 755 PPPP 758 Score = 31.9 bits (69), Expect = 0.73 Identities = 16/50 (32%), Positives = 16/50 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPPPP P G P P P PPPP P Sbjct: 714 PPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPPGCAGLPPPPPPIDVP 763 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/56 (28%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXX-SLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPPP + P +L PPPP PPP P Sbjct: 677 PPPPPPLPVIEGSSLSVPPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSP 732 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/54 (37%), Positives = 20/54 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP PG A G P P P P PPP P P P Sbjct: 280 PPPPPPPPSNT---PGMFAS---SGFQPPPPPPTDFAPPPPPPEPTSELPPPPP 327 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPP-PXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPP 646 PP+ PPPPP P P P P P P P PPP Sbjct: 208 PPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPP 261 Score = 32.3 bits (70), Expect = 0.55 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P K P PP P P Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPP------PSPPRPLAAKLPEPPPIPNMPPTL 258 Query: 668 XP 673 P Sbjct: 259 PP 260 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 206 PPPPRPPPSPPPPPPPPSPSPP 227 >SB_44156| Best HMM Match : Extensin_2 (HMM E-Value=0.05) Length = 1878 Score = 29.9 bits (64), Expect(2) = 0.52 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 1313 PPPPPPPPPPPPPLPP 1328 Score = 25.8 bits (54), Expect(2) = 6.9 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP P Sbjct: 1312 PPPPPPPPPPPPPPLP 1327 Score = 24.6 bits (51), Expect(2) = 6.9 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPP 535 PP+ PPPPPP Sbjct: 1307 PPESPPPPPPPPPPPP 1322 Score = 22.2 bits (45), Expect(2) = 6.9 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +2 Query: 629 PXXPPPPXXXPAPXPXP 679 P PPPP P P P Sbjct: 1314 PPPPPPPPPPPPLPPTP 1330 Score = 21.0 bits (42), Expect(2) = 6.9 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 520 PPPPPP 537 PPPPPP Sbjct: 1311 PPPPPP 1316 Score = 21.0 bits (42), Expect(2) = 0.52 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 520 PPPPPP 537 PPPPPP Sbjct: 1312 PPPPPP 1317 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 31.9 bits (69), Expect = 0.73 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPX--PFXXKXPXXPPPPXXXP 661 PP PPPPP P P F P P P + P PPPP P Sbjct: 1225 PPMGHHMMNMPPPPPAM-------PPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQP 1277 Query: 662 APXPXP 679 P P Sbjct: 1278 PGPPGP 1283 Score = 29.1 bits (62), Expect = 5.1 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPX--PFXXKXPXXPPPPXXXP 661 PP PPPPP P G P P PF P PP P Sbjct: 1224 PPPMGHHMMNMPPPPPAMPPDGPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGP 1283 Query: 662 APXPXP 679 P P Sbjct: 1284 PGPPGP 1289 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 31.5 bits (68), Expect = 0.96 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G G G GGGG G G G G GGGGGG + Sbjct: 777 GDGGGGGDGGGGGGGGG-----GGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 498 FFGGXXXGG 472 GG GG Sbjct: 832 DGGGFGDGG 840 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/77 (25%), Positives = 20/77 (25%) Frame = -3 Query: 866 GXGXGXXGGXXGXXXXXXXXXXXXXXXXXXGXAXPRAAGGXXXXXXXXXXXXGXXGXXXX 687 G G G GG G G GG G Sbjct: 786 GGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADG 845 Query: 686 XGGXAGGGXGXXXGGGG 636 GG GGG G GGGG Sbjct: 846 DGGGGGGGGGGGGGGGG 862 Score = 29.5 bits (63), Expect = 3.9 Identities = 20/77 (25%), Positives = 20/77 (25%) Frame = -3 Query: 866 GXGXGXXGGXXGXXXXXXXXXXXXXXXXXXGXAXPRAAGGXXXXXXXXXXXXGXXGXXXX 687 G G G GG G G GG G Sbjct: 790 GGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDGGG 849 Query: 686 XGGXAGGGXGXXXGGGG 636 GG GGG G GGGG Sbjct: 850 GGGGGGGGGGGGGGGGG 866 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/69 (28%), Positives = 20/69 (28%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G G G GGGG G G G G G GGG Sbjct: 788 GGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYGDGGGFGDGGGYADGDG 847 Query: 498 FFGGXXXGG 472 GG GG Sbjct: 848 GGGGGGGGG 856 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGGV 633 G GG GGG G GGGGV Sbjct: 855 GGGGGGGGGGGGGGGGGGGGGGV 877 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 31.5 bits (68), Expect = 0.96 Identities = 23/77 (29%), Positives = 25/77 (32%), Gaps = 13/77 (16%) Frame = +2 Query: 488 PPKKKXXXXXPPPP-------------PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKX 628 PP K+ PPPP PP P PL P P P + Sbjct: 271 PPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPL--NATPPPPPPSRDQV 328 Query: 629 PXXPPPPXXXPAPXPXP 679 P PPP AP P P Sbjct: 329 PLPPPPLRGQIAPPPPP 345 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/62 (27%), Positives = 20/62 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP + PPPP G+ P P F + P PP PAP Sbjct: 251 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP 310 Query: 668 XP 673 P Sbjct: 311 PP 312 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 494 KKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPX---PXPFXXKXPXXPPPPXXXPA 664 KK PPPPP P P F P P + PPPP Sbjct: 158 KKPSQGSFPPPPP---MGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSG 214 Query: 665 PXPXP 679 P P P Sbjct: 215 PPPPP 219 Score = 28.3 bits (60), Expect(2) = 1.6 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP+ P P Sbjct: 3 PPPPPPGPPPPPSAPSGPVKPP 24 Score = 21.0 bits (42), Expect(2) = 1.6 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 520 PPPPPP 537 PPPPPP Sbjct: 2 PPPPPP 7 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 31.5 bits (68), Expect = 0.96 Identities = 23/77 (29%), Positives = 25/77 (32%), Gaps = 13/77 (16%) Frame = +2 Query: 488 PPKKKXXXXXPPPP-------------PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKX 628 PP K+ PPPP PP P PL P P P + Sbjct: 183 PPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPL--NATPPPPPPSRDQV 240 Query: 629 PXXPPPPXXXPAPXPXP 679 P PPP AP P P Sbjct: 241 PLPPPPLRGQIAPPPPP 257 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/62 (27%), Positives = 20/62 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP + PPPP G+ P P F + P PP PAP Sbjct: 163 PPPMRGPTSGGEPPPPKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAP 222 Query: 668 XP 673 P Sbjct: 223 PP 224 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 494 KKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPX---PXPFXXKXPXXPPPPXXXPA 664 KK PPPPP P P F P P + PPPP Sbjct: 70 KKPSQGSFPPPPP---MGKPPPPSGNKPTFGNSRTSTNGPPPPPHSRHGSAPPPPERSSG 126 Query: 665 PXPXP 679 P P P Sbjct: 127 PPPPP 131 >SB_812| Best HMM Match : FH2 (HMM E-Value=0) Length = 1430 Score = 31.5 bits (68), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -3 Query: 260 FXGGNXXPGNXNXFXPKXPXXXGGGVPNPPK 168 F G P F P P GGGVP PPK Sbjct: 649 FGGIPPPPPGGGMFPPPPPPPPGGGVPGPPK 679 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/77 (24%), Positives = 19/77 (24%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXPXXXXXXXXXXXXX 816 PPPP P PPP PP PP A Sbjct: 103 PPPPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSV 162 Query: 817 XXXXXPXXPPXXPXPXP 867 P PP P P P Sbjct: 163 QLHASPPGPPPAPMPAP 179 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 102 PPPPPPPPPPPPPPPP 117 >SB_13021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 964 Score = 31.1 bits (67), Expect = 1.3 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = -3 Query: 308 PPSXGXVXGXGGXXXXFXGGNXXPGNXNXFXPKXPXXXGGGVPNPPKTLXGXXGPPGS 135 PP G G GG PG + P GG P PP G PPG+ Sbjct: 527 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGPPPPGA 584 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/61 (34%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = -3 Query: 314 GXPPSXGXVXGXGGXXXXFXG---GNXXPGNXNXFXPKXPXXXGGGVPNPPKTLXGXXGP 144 G PP G G GG G G PG P P GG P PP G P Sbjct: 501 GGPPPPGAGQG-GGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQP 559 Query: 143 P 141 P Sbjct: 560 P 560 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = -3 Query: 308 PPSXGXVXGXGGXXXXFXGGNXXPGNXNXFXPKXPXXXGGGVPNPPKTLXGXXGPP 141 PP G G GG PG + P GG P PP G PP Sbjct: 494 PPGAGQGGGPPPPGAGQGGGPPPPGAGQGWGQPPPGAGQGGGPPPPGAGQGGGPPP 549 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 685 PPPPPPPPPPPPPPPPPQPSTP 706 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPP 707 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 605 PXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P PPPP P P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPP 699 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 683 PPPPPPPPPPPPPPPP 698 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 684 PPPPPPPPPPPPPPPP 699 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/67 (26%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXP-----XPFXXKXPXXPPPPX 652 PP PPPPPP P + P+ G P PPPP Sbjct: 686 PPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPPPG 745 Query: 653 XXPAPXP 673 P P Sbjct: 746 QLPGQQP 752 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P PPPP P P P P Sbjct: 675 PIPIQTMVPPPPPPPPPPPPPPPPPPP 701 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P PPPP P+ P P Sbjct: 683 PPPPPPPPPPPPPPPPPPPQPSTPPPP 709 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPP 485 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P PPPP P P P P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPP 486 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPP 487 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 468 PPPPPPPPPPPPPPPPPPPPFP 489 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 469 PPPPPPPPPPPPPPPPPPPFPP 490 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P PPPP P P P P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 470 PPPPPPPPPPPPPPPPPPFPPP 491 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 471 PPPPPPPPPPPPPPPPPFPPPP 492 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 472 PPPPPPPPPPPPPPPPFPPPPP 493 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 475 PPPPPPPPPPPPPFPPPPPPTP 496 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P PPPP P P P P Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPFPPPPP 493 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 590 GXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 G P P P P PPPP P P P P Sbjct: 461 GQAPPPPPPPPPPPPPPPPP-PPPPPPPFP 489 >SB_43066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 54 PPPPPPPPPPPPPPPPPPSSSP 75 Score = 27.5 bits (58), Expect(2) = 3.7 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP P P Sbjct: 57 PPPPPPPPPPPPPPPSSSPSRP 78 Score = 21.0 bits (42), Expect(2) = 3.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 520 PPPPPP 537 PPPPPP Sbjct: 55 PPPPPP 60 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 30.7 bits (66), Expect = 1.7 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP PG P G P P P PP P P P P Sbjct: 1662 PPPPPPPA------PGPPGP---DGPMGLPGPQGPDGPKGPPGPPGLPGPQGIP 1706 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 605 PXPFXXKXPXXPPPPXXXPAPXPXP 679 P P + P PPPP P P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 867 PPPPPPPPPPPPPPPP 882 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 868 PPPPPPPPPPPPPPPP 883 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 869 PPPPPPPPPPPPPPPP 884 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 870 PPPPPPPPPPPPPPPP 885 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXP 673 P P P P PPPP P P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPP 884 >SB_26939| Best HMM Match : Drf_FH1 (HMM E-Value=9.2) Length = 188 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 31 PPPPSPPPSPPPPSPP 46 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 154 PPPPSPPPSPPPPSPP 169 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 425 PPPPPPAPLPPPPPPP 440 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 1164 PPPPPSSPSPPPPPPP 1179 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP+ P P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPP 1178 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 29.9 bits (64), Expect = 2.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPP PP Sbjct: 234 PPPPAAAPPPPPPPPP 249 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +2 Query: 491 PKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA 664 PK++ PP P P A AP P P P PPPP PA Sbjct: 205 PKQQKATPVNPPEPDYLEPTPPPPAAPAP--------PPPPAAAPPPPPPPPPVKKPA 254 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 605 PXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P PPPP P P P P Sbjct: 223 PTPPPPAAPAPPPPPAAAPPPPPPP 247 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 3/57 (5%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP---PPPXXXPAPXPXP 679 PP PP P P F P P P P PP P P P P Sbjct: 285 PPMTPPPAVVTAPPPAPPLPNFTSPSPPPPPPLPPAMPAMDDLLPPEVLSPPPPPPP 341 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 29.1 bits (62), Expect = 5.1 Identities = 16/49 (32%), Positives = 16/49 (32%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPPP PG P G P P P PP P P Sbjct: 29 PPPPPPYEAPPPPPGPPGP---DGPPGFPGPQGPNGPKGPPGLPGPPGP 74 >SB_36007| Best HMM Match : Collagen (HMM E-Value=9e-25) Length = 311 Score = 29.1 bits (62), Expect = 5.1 Identities = 18/51 (35%), Positives = 19/51 (37%), Gaps = 1/51 (1%) Frame = +2 Query: 530 PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPP-PXXXPAPXPXP 679 PP PG AP+ P P K P P P P PAP P P Sbjct: 152 PPGPPGARGEPGQQAPMMIQVSRPGPN----KGPPGPGPGPGPGPAPGPGP 198 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 524 PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP P P PL P P P PP P PAP P P Sbjct: 271 PPAPPNPSIPAPPNPSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAP-PNP 321 >SB_13198| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/80 (25%), Positives = 24/80 (30%), Gaps = 2/80 (2%) Frame = -3 Query: 350 PXXDFXGXKIXX--GXPPSXGXVXGXGGXXXXFXGGNXXPGNXNXFXPKXPXXXGGGVPN 177 P DF G + G PP V G + N P P G+P Sbjct: 253 PEVDFKGRDLGSREGAPPDYNAVTGNHPYLPPYDASAAAYPPQNTNTPYPPLEPSAGLPY 312 Query: 176 PPKTLXGXXGPPGSKPXHFL 117 PP+ PP FL Sbjct: 313 PPQGATASPYPPADNSAPFL 332 >SB_49263| Best HMM Match : Surp (HMM E-Value=1e-28) Length = 641 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP PPPPPP PL P P PPPP P Sbjct: 343 PPIMSVADMIPPPPPPPGEGPPEDTQVAVPL----GVPYPVTSHATPTIIPPPPDLQP 396 >SB_33549| Best HMM Match : Collagen (HMM E-Value=2e-05) Length = 346 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/49 (30%), Positives = 15/49 (30%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PP PG P G P P PP P P P Sbjct: 81 PPGPPGIPGPRGLPGYRGPKGPPGYQGMPGIAGAPGPRGPPGPMGPPGP 129 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPP 684 TPPPP P PPP P Sbjct: 100 TPPPPTMPPTPPPPQTP 116 >SB_10615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1884 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGGV 633 G GG AGGG G GGGG+ Sbjct: 1795 GEGMGGGGMAGGGGGMGGGGGGM 1817 >SB_6245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 2/56 (3%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXG--XXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P PP P P A P P P PF P PP P P P P Sbjct: 759 PKPPAPPQFAPVPPPCAPIPPMPCSAPLPPAPAPF-SAAPHLPPAPNISAEPPPPP 813 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/60 (31%), Positives = 21/60 (35%) Frame = -3 Query: 314 GXPPSXGXVXGXGGXXXXFXGGNXXPGNXNXFXPKXPXXXGGGVPNPPKTLXGXXGPPGS 135 G PP+ G G G P + P P GG P PP G GPP S Sbjct: 29 GYPPAPGGYPPAPGGYPPSGGYGYPPAGG--YPPPQPGYAGG--PPPPGIAPGIGGPPPS 84 >SB_34754| Best HMM Match : TSP_1 (HMM E-Value=7.4e-12) Length = 439 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P P+ P P P PPP AP P Sbjct: 65 PPPPPVVTEAPTTVP---PPVVTDAPTTVPPPVVTDAPTTVPPPVVTDAPTTVP 115 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/41 (31%), Positives = 13/41 (31%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAA 759 PPPP PPP PP P PP A Sbjct: 123 PPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTA 163 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP PP P A P P P PF P PPPP P Sbjct: 164 PPAPPAAPFMAPAAPPAPPPPGAPAAPPAP-PFGGP-PSAPPPPPAPP 209 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.315 0.154 0.546 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,519,917 Number of Sequences: 59808 Number of extensions: 272376 Number of successful extensions: 4790 Number of sequences better than 10.0: 47 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2241 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -