BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_O01 (904 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 40 0.002 At1g61080.1 68414.m06877 proline-rich family protein 40 0.002 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 39 0.004 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 38 0.007 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 38 0.009 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 37 0.016 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 37 0.021 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 36 0.028 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 36 0.028 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 36 0.049 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 35 0.064 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 35 0.085 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 35 0.085 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 35 0.085 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 35 0.085 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 34 0.11 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 34 0.11 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 34 0.11 At3g50130.1 68416.m05480 expressed protein ; expression supporte... 34 0.15 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 33 0.20 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 33 0.20 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 33 0.26 At5g46730.1 68418.m05757 glycine-rich protein 33 0.26 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 33 0.26 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 33 0.34 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 33 0.34 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.34 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 32 0.45 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 32 0.60 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 32 0.60 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 32 0.60 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 31 0.79 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 31 0.79 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 31 0.79 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 31 0.79 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 31 0.79 At4g18570.1 68417.m02749 proline-rich family protein common fami... 31 1.0 At3g51290.1 68416.m05614 proline-rich family protein 31 1.0 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 31 1.0 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 30 1.8 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 30 1.8 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 30 1.8 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 30 2.4 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 30 2.4 At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (AB... 30 2.4 At1g26150.1 68414.m03192 protein kinase family protein similar t... 30 2.4 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 3.2 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 29 3.2 At1g62240.1 68414.m07021 expressed protein 29 3.2 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 27 3.7 At5g22560.1 68418.m02635 hypothetical protein contains Pfam prof... 29 4.2 At4g01985.1 68417.m00265 expressed protein 29 4.2 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 29 4.2 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 29 5.6 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 29 5.6 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 29 5.6 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 29 5.6 At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-conta... 29 5.6 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 29 5.6 At2g30560.1 68415.m03722 glycine-rich protein 29 5.6 At4g29240.1 68417.m04182 leucine-rich repeat family protein / ex... 24 6.4 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 28 7.4 At5g38560.1 68418.m04662 protein kinase family protein contains ... 28 7.4 At4g16240.1 68417.m02464 hypothetical protein 28 7.4 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 28 7.4 At3g10525.1 68416.m01263 expressed protein 28 7.4 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 28 7.4 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 28 7.4 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 28 7.4 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 28 7.4 At1g10620.1 68414.m01204 protein kinase family protein contains ... 28 7.4 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 28 9.7 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 28 9.7 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 28 9.7 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 28 9.7 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 9.7 At3g50180.1 68416.m05486 hypothetical protein 28 9.7 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 28 9.7 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 28 9.7 At1g75550.1 68414.m08780 glycine-rich protein 28 9.7 At1g27710.1 68414.m03387 glycine-rich protein 28 9.7 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 28 9.7 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 28 9.7 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 39.9 bits (89), Expect = 0.002 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P P PPP P P Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPP 490 Query: 668 XP 673 P Sbjct: 491 PP 492 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P PPPP P P Sbjct: 432 PPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPP 491 Query: 668 XP 673 P Sbjct: 492 PP 493 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P P PPPP P Sbjct: 428 PPSPPPPVYSPPPPPPPPPPVYSPPPPPPP-------PPPPPVYSPPPPPPPPPPPPPVY 480 Query: 668 XPXP 679 P P Sbjct: 481 SPPP 484 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P P PPP P P Sbjct: 446 PPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPP 505 Query: 668 XP 673 P Sbjct: 506 PP 507 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/65 (32%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXP-XXPPPPXXXPA 664 PP PPPPPP P P P P P P PPPP + Sbjct: 461 PPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSS 520 Query: 665 PXPXP 679 P P P Sbjct: 521 PPPPP 525 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/62 (33%), Positives = 22/62 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P + P P P P P PPPP P P Sbjct: 460 PPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPP-----PPPPPPPVYSPPP 514 Query: 668 XP 673 P Sbjct: 515 PP 516 Score = 37.5 bits (83), Expect = 0.012 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P PPPP P P Sbjct: 444 PPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPP----SPPPPPPPVYSPPP 499 Query: 668 XPXP 679 P P Sbjct: 500 PPPP 503 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/64 (31%), Positives = 22/64 (34%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P + P PPPP +P Sbjct: 459 PPPPVYSPPPPPPPPPPPPPVYSPPPPSPP------PPPPPVYSPPPPPPPPPPPPVYSP 512 Query: 668 XPXP 679 P P Sbjct: 513 PPPP 516 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P P++ P P P PPP P P P P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 35.1 bits (77), Expect = 0.064 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PPPP P P P Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP----PPPPPPPPVYSPPPPSPP 488 Score = 35.1 bits (77), Expect = 0.064 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PP P P P P Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 35.1 bits (77), Expect = 0.064 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P +P P P P P PPPP P P Sbjct: 492 PPVYSPPPPPPPPPPPPVYSPPPPPVYSSP--PPPPSPAPTPVYCTRP-PPPPPHSPPPP 548 Query: 668 XPXP 679 P Sbjct: 549 QFSP 552 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/85 (23%), Positives = 21/85 (24%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXPXXXXXXXXXXXX 813 +PPPP P PPP PP P PP P Sbjct: 430 SPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPP 489 Query: 814 XXXXXXPXXPPXXPXPXPXXXXXXP 888 PP P P P P Sbjct: 490 PPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P P P PPPP P P P Sbjct: 457 PPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPP 508 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P PPP P +P P P + P PPPP P P P P Sbjct: 408 PSPPPPAPIFSTPPTLTSP---PPPSPPPPVYSPPPPPPPPPPVYSPPPPPPP 457 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/62 (30%), Positives = 20/62 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P +P P P P PPPP P Sbjct: 458 PPPPPVYSPPPPPPPPPPPPPVYSPPPPSP----PPPPPPVYSPPPPPPPPPPPPVYSPP 513 Query: 668 XP 673 P Sbjct: 514 PP 515 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/67 (34%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PP PPPP P + AP P P P P PPPP Sbjct: 497 PPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPP-----PHSPPPPQFS 551 Query: 659 PAPXPXP 679 P P P P Sbjct: 552 P-PPPEP 557 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXP---XPXPFXXKXPXXPPP---PXXXPAPXPXP 679 PPPPP P P + P P P P PPP P P P P P Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 32.3 bits (70), Expect = 0.45 Identities = 16/55 (29%), Positives = 16/55 (29%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPPP P PPPP P PP PP Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPP 553 Score = 31.5 bits (68), Expect = 0.79 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP-PPPXXXPA 664 PP PPPPPP P P P P P P P P Sbjct: 477 PPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTR 536 Query: 665 PXPXP 679 P P P Sbjct: 537 PPPPP 541 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/54 (29%), Positives = 18/54 (33%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPP P P + P P P PPPP +P P P Sbjct: 552 PPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTP 605 Score = 31.5 bits (68), Expect = 0.79 Identities = 19/67 (28%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPP---PPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPP PPP P P+ P P + PPPP Sbjct: 602 PPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSS---PPPPPVYY 658 Query: 659 PAPXPXP 679 +P P P Sbjct: 659 SSPPPPP 665 Score = 31.1 bits (67), Expect = 1.0 Identities = 18/64 (28%), Positives = 20/64 (31%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP P + P P P P P PPP +P Sbjct: 582 PPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSP 641 Query: 668 XPXP 679 P P Sbjct: 642 PPPP 645 Score = 31.1 bits (67), Expect = 1.0 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P PP +P Sbjct: 651 PPPPPVYYSSPPPPPPVHYSSPPPPEVHY------HSPPPSPVHYSSPPPPPSAPCEESP 704 Query: 668 XPXP 679 P P Sbjct: 705 PPAP 708 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP P P AP+F P P PPPP P P P P Sbjct: 396 PPVVTPLPPPSLPSPPPPAPIFST-----PPTLTSPPPPSPPPPVYSPPPPPPP 444 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PP PPP P P P P P PPPP P P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP--PPPPSPAPTP 531 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/69 (28%), Positives = 22/69 (31%), Gaps = 5/69 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPP---PPXXXXXXXXPGAXAPLFXXGXXP--XPXPFXXKXPXXPPPPX 652 PP PPPP PP P P+ P P P PPPP Sbjct: 565 PPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPC 624 Query: 653 XXPAPXPXP 679 +P P P Sbjct: 625 IEYSPPPPP 633 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/70 (28%), Positives = 22/70 (31%), Gaps = 6/70 (8%) Frame = +2 Query: 488 PPKKKXXXXXPPPPP---PXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP---PPP 649 PP PPP P P P +P P P P+ P P PPP Sbjct: 513 PPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPP 572 Query: 650 XXXPAPXPXP 679 P P P Sbjct: 573 HSPPPPHSPP 582 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP+ PPP P + P P P P P PP P P P Sbjct: 554 PPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSP--PPTPVYSPPP 611 Query: 668 XP 673 P Sbjct: 612 PP 613 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 39.9 bits (89), Expect = 0.002 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP--FXXKXPXXPPPPXXXP 661 PP PPPPPP P P P P P P PPPP Sbjct: 514 PPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNR 573 Query: 662 APXPXP 679 AP P P Sbjct: 574 APSPPP 579 Score = 39.5 bits (88), Expect = 0.003 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P+ P P P PPPP P P Sbjct: 540 PPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPP---PPP 596 Query: 668 XP 673 P Sbjct: 597 MP 598 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP----FXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PPPP AP P P Sbjct: 509 PPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPP 566 Score = 35.1 bits (77), Expect = 0.064 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP A PL P P PPPP PA P Sbjct: 417 PPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMP 468 Score = 30.7 bits (66), Expect = 1.4 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 5/69 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP-GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP- 661 PP PPPPPP P AP P P P P PP P Sbjct: 444 PPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLPPAVMPLKHFAPPPPTPPAFKPL 503 Query: 662 ---APXPXP 679 AP P P Sbjct: 504 KGSAPPPPP 512 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/58 (29%), Positives = 17/58 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP PPPPPP P G P P P PPP P Sbjct: 554 PPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP P PPPP P PPPA P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPP--PPPPPAVMPLKHFA 473 Query: 700 P 702 P Sbjct: 474 P 474 Score = 29.1 bits (62), Expect = 4.2 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 13/67 (19%) Frame = +2 Query: 518 PPPPPPXXXXXXXX---------PGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP--- 661 PPPPPP P A PL P P P PPPP P Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAA 533 Query: 662 -APXPXP 679 AP P P Sbjct: 534 VAPPPPP 540 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/82 (24%), Positives = 21/82 (25%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP L P + PPP PPP PP Sbjct: 508 PPPPPPPPLPTTIAAPPPPP------PPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAA 561 Query: 700 PXXXXXXXXXXXXXXXPPAARG 765 P PP G Sbjct: 562 PPPPPPPPMQNRAPSPPPMPMG 583 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 39.1 bits (87), Expect = 0.004 Identities = 21/64 (32%), Positives = 23/64 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P + P P P+ P P PP P P Sbjct: 392 PPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYV--YPPPPPPYV--YPPPPSPPYVYPPP 447 Query: 668 XPXP 679 P P Sbjct: 448 PPSP 451 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/62 (30%), Positives = 21/62 (33%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P ++ P P P P PPP P P Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Query: 668 XP 673 P Sbjct: 439 SP 440 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P + P P P PPPP P P P Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP PPP P P P P P+ P PPPP P P P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSP-PPPPPSPPPYVYPPP 428 Score = 31.5 bits (68), Expect = 0.79 Identities = 19/75 (25%), Positives = 20/75 (26%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXPXXXXXXXXXXXXX 816 PPPP P PPP PP P PP+ P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPS 439 Query: 817 XXXXXPXXPPXXPXP 861 P PP P P Sbjct: 440 PPYVYP-PPPPSPQP 453 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 +PPPP P PPP PP P Sbjct: 378 SPPPPPPPPPPPPPPPPPPPPPP 400 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/86 (23%), Positives = 21/86 (24%), Gaps = 1/86 (1%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXPXXXXXXXXXXXX 813 +PP P P PPP PP P PP P Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVY 434 Query: 814 XXXXXXP-XXPPXXPXPXPXXXXXXP 888 P PP P P P P Sbjct: 435 PPPPSPPYVYPPPPPSPQPYMYPSPP 460 Score = 29.1 bits (62), Expect = 4.2 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +2 Query: 590 GXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 G P P P PPPP P P P P Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPP 402 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 38.3 bits (85), Expect = 0.007 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P P P P PPPP P P P Sbjct: 16 PPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRP 67 Score = 35.1 bits (77), Expect = 0.064 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPP 646 PP + PPPPPP P PL P P P P PP Sbjct: 20 PPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPP 72 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 37.9 bits (84), Expect = 0.009 Identities = 23/64 (35%), Positives = 23/64 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP P P A LF P P P P PPPP P P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALF----PPLPPP-----PSQPPPPPLSPPP 1119 Query: 668 XPXP 679 P P Sbjct: 1120 SPPP 1123 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 640 PPPXXXPXPPPAXPPXXXXXP 702 PPP P PPP PP P Sbjct: 1104 PPPPSQPPPPPLSPPPSPPPP 1124 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 37.1 bits (82), Expect = 0.016 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP + PPPPPP P AP P K PPPP P P Sbjct: 589 PPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPP 648 Query: 668 XPXP 679 P Sbjct: 649 TRIP 652 Score = 35.9 bits (79), Expect = 0.037 Identities = 20/58 (34%), Positives = 20/58 (34%), Gaps = 4/58 (6%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPL----FXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P A PL G P P P PPPP P P P Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPP 741 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 491 PKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 P K PPPPPP P A P P P P P PP P P Sbjct: 567 PINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPP 625 Score = 34.7 bits (76), Expect = 0.085 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P AP P P PPP PAP P P Sbjct: 682 PPPPPPPKANISNAPKPPAP---PPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 34.7 bits (76), Expect = 0.085 Identities = 23/65 (35%), Positives = 23/65 (35%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP-XXXPA 664 PPK PP PP GA P P P P K P PPPP P Sbjct: 687 PPKANISNAPKPPAPPPLPPSSTRLGAPPP-------PPPPPL-SKTPAPPPPPLSKTPV 738 Query: 665 PXPXP 679 P P P Sbjct: 739 PPPPP 743 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P P P P + P P P P P Sbjct: 575 PPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPP 626 Score = 30.7 bits (66), Expect = 1.4 Identities = 23/92 (25%), Positives = 26/92 (28%), Gaps = 6/92 (6%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXS------LXXXXXXTPPPPXXXPXPPPAXP 681 PPPPPP P + L TPPPP P PPP P Sbjct: 527 PPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPP---PPPPPPLP 583 Query: 682 PXXXXXPXXXXXXXXXXXXXXXPPAARGXAXP 777 P PP++R P Sbjct: 584 SRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSP 615 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPP P P+ P P P PPP P P P P Sbjct: 548 PPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPP 601 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP + +P P P F P P P P P Sbjct: 482 PPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPP 533 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/54 (31%), Positives = 17/54 (31%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP AP P P P PP P P P P Sbjct: 639 PPPPPPPPPPTRIPAAKCAP-----PPPPPPPTSHSGSIRVGPPSTPPPPPPPP 687 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 6/60 (10%) Frame = +2 Query: 518 PPPPPPXXXXXXXXP--GAXAPLFXXGXXPXPXPFXXKXPXXPPP----PXXXPAPXPXP 679 PPPPPP P P+ P P P PPP P P P P P Sbjct: 546 PPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPP 605 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP P S PPPP P PP P Sbjct: 600 PPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPP-PPPPTRIPAAKCAP 658 Query: 700 P 702 P Sbjct: 659 P 659 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/67 (26%), Positives = 19/67 (28%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP-- 661 PP PPPP P P P P P + PPP Sbjct: 702 PPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGS 761 Query: 662 -APXPXP 679 AP P P Sbjct: 762 NAPPPPP 768 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPF--XXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P A G P P P K PPPP P P P Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPP 104 Score = 31.1 bits (67), Expect = 1.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 +PPPP P PPP PP P Sbjct: 41 SPPPPPPPPPPPPPPPPPPPPPP 63 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 43 PPPPPPPPPPPPPPPPPPPPPP 64 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 575 PLFXXGXXPXPXPFXXKXPXXPPPPXXXPA 664 PLF P P P P PPPP PA Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPA 65 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/53 (30%), Positives = 16/53 (30%), Gaps = 1/53 (1%) Frame = +3 Query: 519 PPPPPPXTXXXXXXXXXXXXXXXXXXXXXPXPXXXKXXHX-PPPPXXPXPPXR 674 PPPPPP T P P PPPP P P R Sbjct: 75 PPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLPRRHPPPPRSPEKPKR 127 Score = 28.7 bits (61), Expect = 5.6 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 605 PXPFXXKXPXXPPPPXXXPAPXPXP 679 P F P PPPP P P P P Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPP 59 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/56 (28%), Positives = 18/56 (32%), Gaps = 1/56 (1%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXP-XPPPAXPP 684 PPPPPP P + +PPPP P PP PP Sbjct: 52 PPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPP 107 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 36.3 bits (80), Expect = 0.028 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPP---PXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPP P P PG +PL G P P P P P Sbjct: 166 PPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDS 225 Query: 659 PAPXPXP 679 P P P P Sbjct: 226 PLPLPGP 232 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P P P P PPP P P P Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGP-DSPLPLPGPPPSPSPTPGP 214 Score = 32.3 bits (70), Expect = 0.45 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P PPP PG +PL G P P P P P P P P P Sbjct: 230 PGPPPSSSPT---PGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGP 279 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/54 (31%), Positives = 19/54 (35%), Gaps = 1/54 (1%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPP-PXXXPAPXPXP 679 P P P PG +PL G P P P P P P+P P P Sbjct: 208 PSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGP 261 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP P P + P+ G P P P P PP P P P P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP 56 Score = 35.1 bits (77), Expect = 0.064 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPK + PP PP P A P P P P P PP P P P Sbjct: 55 PPKPQPKPVPPPACPPTPPKPQPKP-APPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVP 113 Query: 668 XPXP 679 P Sbjct: 114 PHGP 117 Score = 35.1 bits (77), Expect = 0.064 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPK + PP P P +P P P P P P P P+P Sbjct: 72 PPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSP 131 Query: 668 XPXP 679 P P Sbjct: 132 KPAP 135 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/66 (31%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPP-PPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPP-PPXXXP 661 P K P P P P P A +P P P P P PP PP P Sbjct: 18 PSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQP 77 Query: 662 APXPXP 679 P P P Sbjct: 78 KPAPPP 83 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 P PPP P A P P P P P PP P P P P Sbjct: 52 PSPPPKPQPKPVPPPACPPT-PPKPQPKPAPPPEPKPAPPPAPKPVPCPSP 101 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPG-AXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P PP PG + P P P P P PPP P P P P Sbjct: 12 PVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPP 66 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP+ K PP P P P A P P P P P P P PAP Sbjct: 82 PPEPKPAP--PPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP----APAPTPAPSPKPAP 135 Query: 668 XP 673 P Sbjct: 136 SP 137 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PP P P PPPA PP Sbjct: 55 PPKPQPKPVPPPACPP 70 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPP 643 PP PPPPPP P P P P P K P PP Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPP 436 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P P K PPPP Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPP---PPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKG 431 Query: 668 XPXP 679 P P Sbjct: 432 PPKP 435 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP PP P P P P P PPPP A P P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP 424 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 35.1 bits (77), Expect = 0.064 Identities = 18/54 (33%), Positives = 20/54 (37%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P+ P P P + P PP P P P P Sbjct: 28 PPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPP---PPPPPLP 78 Score = 33.9 bits (74), Expect = 0.15 Identities = 23/69 (33%), Positives = 25/69 (36%), Gaps = 5/69 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP-----X 652 PP + PPPPPP APL P P P + P PPPP Sbjct: 15 PPMRGRVPLPPPPPPPPPPMR-----RRAPL----PPPPPPPMRRRAPLPPPPPPAMRRR 65 Query: 653 XXPAPXPXP 679 P P P P Sbjct: 66 VLPRPPPPP 74 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PP + PPPPPP P P P P P PPPP Sbjct: 31 PPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPP--------PPPP 76 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 34.7 bits (76), Expect = 0.085 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = +2 Query: 494 KKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 K+ PPP P A PL G P P P PPPP P P P Sbjct: 646 KRPPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPP---PGGGPPPPPGGGPPPPP 702 Query: 674 XP 679 P Sbjct: 703 PP 704 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 34.7 bits (76), Expect = 0.085 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA- 664 PP PP PP P P+ P P P PPPP P+ Sbjct: 85 PPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSV 144 Query: 665 PXPXP 679 P P P Sbjct: 145 PSPTP 149 Score = 32.7 bits (71), Expect = 0.34 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPP--PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP P PP PP P P+ P P P PPPP P Sbjct: 101 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 160 Query: 662 A-PXPXP 679 + P P P Sbjct: 161 SVPSPTP 167 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPP P P + P P P P P PPP P P P P Sbjct: 136 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSP-PPPTP 188 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 1/54 (1%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA-PXPXP 679 PPPP P + P P P P P PPPP P+ P P P Sbjct: 83 PPPPTPSVPSPTPPVSPPPPTPTPSVPSPTP-----PVSPPPPTPTPSVPSPTP 131 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/72 (27%), Positives = 21/72 (29%), Gaps = 8/72 (11%) Frame = +2 Query: 488 PPKKKXXXXXPPPP--PPXXXXXXXXPGAXAPLFXXGXXPXP------XPFXXKXPXXPP 643 PP P PP PP P P+ P P P PP Sbjct: 119 PPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPP 178 Query: 644 PPXXXPAPXPXP 679 PP P P P P Sbjct: 179 PPVSPPPPTPTP 190 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPP P P P P P P PP P P P P Sbjct: 153 PPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTP-PTP 205 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPP P P + P P P P P P P P P P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 34.7 bits (76), Expect = 0.085 Identities = 17/54 (31%), Positives = 18/54 (33%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P + P P P P PPP P P P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/63 (26%), Positives = 21/63 (33%), Gaps = 3/63 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLF---XXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPPP P P++ P P + PPPP Sbjct: 608 PPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVY 667 Query: 659 PAP 667 +P Sbjct: 668 YSP 670 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP P PPPP P P P P PPPP P Sbjct: 528 PPPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCPPTTQSPPPPKYEQTP 587 Query: 668 XP 673 P Sbjct: 588 SP 589 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXP 681 PPPPPP P L +PPPP PPP P Sbjct: 502 PPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPP-SPPPPYIYSSPPPPSP 554 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 34.7 bits (76), Expect = 0.085 Identities = 20/54 (37%), Positives = 22/54 (40%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P+ K P PPPP +P P P Sbjct: 169 PPPPPPYVYQSPPPP----PYVYSS--PPPPPYVYKSP--PPPPYVYSSPPPPP 214 Score = 34.7 bits (76), Expect = 0.085 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 270 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 327 Query: 659 PAPXPXP 679 +P P P Sbjct: 328 TSPPPPP 334 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 80 PPPPPYVYNSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 137 Query: 659 PAPXPXP 679 +P P P Sbjct: 138 SSPPPPP 144 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 110 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 167 Query: 659 PAPXPXP 679 P P P Sbjct: 168 SPPPPPP 174 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 170 PPPPPYVYQSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 227 Query: 659 PAPXPXP 679 +P P P Sbjct: 228 SSPPPPP 234 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 190 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 247 Query: 659 PAPXPXP 679 +P P P Sbjct: 248 SSPPPPP 254 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 210 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 267 Query: 659 PAPXPXP 679 +P P P Sbjct: 268 SSPPPPP 274 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 230 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 287 Query: 659 PAPXPXP 679 +P P P Sbjct: 288 SSPPPPP 294 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPP P + P P P+ K P PPPP +P Sbjct: 70 PPPPPYVYSSPPPPPYVYNSPPPPPYVYSS-------PPPPPYVYKSP--PPPPYVYSSP 120 Query: 668 XPXP 679 P P Sbjct: 121 PPPP 124 Score = 32.7 bits (71), Expect = 0.34 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ P PPPP Sbjct: 120 PPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPP--PPPPYVY 177 Query: 659 PAPXPXP 679 +P P P Sbjct: 178 QSPPPPP 184 Score = 32.3 bits (70), Expect = 0.45 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ P PPPP Sbjct: 280 PPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSP--PPPPYVY 337 Query: 659 PAPXPXP 679 +P P P Sbjct: 338 KSPPPPP 344 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 1/62 (1%) Frame = +2 Query: 497 KKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPF-XXKXPXXPPPPXXXPAPXP 673 KK PPPPPP P P P P PPPP PAP P Sbjct: 682 KKPALPRPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP-P 740 Query: 674 XP 679 P Sbjct: 741 TP 742 Score = 31.1 bits (67), Expect = 1.0 Identities = 17/55 (30%), Positives = 18/55 (32%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPPP P + PPPP P PPP PP Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPP---PPPPPPAPP 740 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPPPP G A P P P PPPP P P Sbjct: 731 PPPPPPPAPPTPQSNGISAMKSSPPAPPAP-PRLPTHSASPPPPTAPPPP 779 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/50 (28%), Positives = 15/50 (30%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPP 669 PPPPPP P +PPPP P PP Sbjct: 731 PPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPP 780 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/64 (31%), Positives = 23/64 (35%), Gaps = 1/64 (1%) Frame = +2 Query: 491 PKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPP-PPXXXPAP 667 P+ + PPPPPP P P P P P + P P PP P P Sbjct: 54 PEPEPADCPPPPPPPPCPPPPSPPPCPPP-----PSPPPSPPPPQLPPPPQLPPPAPPKP 108 Query: 668 XPXP 679 P P Sbjct: 109 QPSP 112 Score = 31.1 bits (67), Expect = 1.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P PPPP P P P P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPP 78 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P P P P P P PPPP P P P Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPP 83 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 71 PPPPSPPPCPPPPSPPPSPPPP 92 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PP PPP PP P + P P P K PP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 +PPP P PPP+ PP P Sbjct: 75 SPPPCPPPPSPPPSPPPPQLPPP 97 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 360 PPPSPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 417 Query: 659 PAPXPXP 679 +P P P Sbjct: 418 SSPPPPP 424 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 60 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSP--PPPPYVY 117 Query: 659 PAPXPXP 679 +P P P Sbjct: 118 SSPPPPP 124 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 100 PPPPPYIYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP--PPPPYVY 157 Query: 659 PAPXPXP 679 +P P P Sbjct: 158 SSPPPPP 164 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 120 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 177 Query: 659 PAPXPXP 679 +P P P Sbjct: 178 SSPPPPP 184 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 140 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 197 Query: 659 PAPXPXP 679 +P P P Sbjct: 198 SSPPPPP 204 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 160 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 217 Query: 659 PAPXPXP 679 +P P P Sbjct: 218 SSPPPPP 224 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 180 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 237 Query: 659 PAPXPXP 679 +P P P Sbjct: 238 SSPPPPP 244 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 200 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 257 Query: 659 PAPXPXP 679 +P P P Sbjct: 258 SSPPPPP 264 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 220 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 277 Query: 659 PAPXPXP 679 +P P P Sbjct: 278 SSPPPPP 284 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 240 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 297 Query: 659 PAPXPXP 679 +P P P Sbjct: 298 SSPPPPP 304 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 260 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 317 Query: 659 PAPXPXP 679 +P P P Sbjct: 318 SSPPPPP 324 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 300 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPPPYVYKSP--PPPPYVY 357 Query: 659 PAPXPXP 679 +P P P Sbjct: 358 SSPPPSP 364 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 320 PPPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSP--PPPPYVY 377 Query: 659 PAPXPXP 679 +P P P Sbjct: 378 SSPPPPP 384 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 340 PPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 397 Query: 659 PAPXPXP 679 +P P P Sbjct: 398 SSPPPPP 404 Score = 33.9 bits (74), Expect = 0.15 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 380 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 437 Query: 659 PAPXPXP 679 +P P P Sbjct: 438 SSPPPPP 444 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 80 PPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 137 Query: 659 PAPXPXP 679 +P P P Sbjct: 138 NSPPPPP 144 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/67 (31%), Positives = 24/67 (35%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PPPP Sbjct: 280 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP--PPPPYVY 337 Query: 659 PAPXPXP 679 +P P P Sbjct: 338 NSPPPPP 344 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/64 (31%), Positives = 23/64 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPP P + P P P+ K P PPPP +P Sbjct: 50 PPPPPYVYSSPPPPPYIYKSPPPPPYVYSS-------PPPPPYIYKSP--PPPPYVYSSP 100 Query: 668 XPXP 679 P P Sbjct: 101 PPPP 104 Score = 32.7 bits (71), Expect = 0.34 Identities = 20/67 (29%), Positives = 23/67 (34%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ P PPPP Sbjct: 390 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP--PPPPYVY 447 Query: 659 PAPXPXP 679 +P P P Sbjct: 448 KSPSPPP 454 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/65 (29%), Positives = 21/65 (32%), Gaps = 3/65 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP---GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P + P P P P+ K P PP Sbjct: 400 PPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKS 459 Query: 659 PAPXP 673 P P P Sbjct: 460 PPPPP 464 >At3g50130.1 68416.m05480 expressed protein ; expression supported by MPSS Length = 564 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P P F K PPPP P P Sbjct: 9 PPPPPPPPPSFRSIPRPPPPPSFRSIPPRRHFFKKKSKSLPPPPPPLPPARP 60 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/54 (31%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P + P P+ PPPP P P P P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYP------PPPYHHYITPSPPPPRPLPPPPPPP 116 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 TP PP P PPP PP P Sbjct: 100 TPSPPPPRPLPPPPPPPLHFSSP 122 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +2 Query: 605 PXPFXXKXPXXPPPPXXXPAPXPXP 679 P P + P PPPP P P P P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSP 85 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 33.5 bits (73), Expect = 0.20 Identities = 26/123 (21%), Positives = 27/123 (21%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPPP P +PPPP P PP PP Sbjct: 518 PPPPPPVY-----SPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 572 Query: 700 PXXXXXXXXXXXXXXXPPAARGXAXPXXXXXXXXXXXXXXXXXXPXXPPXXPXPXPXXXX 879 P PP P P PP P P Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP 632 Query: 880 XXP 888 P Sbjct: 633 PPP 635 Score = 31.5 bits (68), Expect = 0.79 Identities = 19/65 (29%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPP---PXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPPP P P +P P P PPPP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYS 586 Query: 659 PAPXP 673 P P P Sbjct: 587 PPPPP 591 Score = 31.5 bits (68), Expect = 0.79 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +1 Query: 523 PPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPP P S PPPP P PPP P Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSP 669 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P P P P PPP P P Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/60 (26%), Positives = 17/60 (28%) Frame = +1 Query: 523 PPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXXP 702 PPPPP P +PPPP P PP PP P Sbjct: 587 PPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSP 646 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 P K + PP PPPP P +P P P P PPP Sbjct: 486 PVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSP 545 Query: 659 PAPXPXP 679 P P P Sbjct: 546 PPPVHSP 552 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXP---XXPPPPXXXPAP 667 PPPPP P P P P P P PPPP P P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPP 561 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/53 (26%), Positives = 15/53 (28%) Frame = +1 Query: 526 PPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPP P +PPPP P PPP P Sbjct: 609 PPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSP 661 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/47 (27%), Positives = 14/47 (29%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXP 777 PPPP P PP PP P PP + P Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/59 (25%), Positives = 16/59 (27%) Frame = +1 Query: 526 PPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXXP 702 PPPP P +PPPP P PP PP P Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSP 653 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/55 (27%), Positives = 15/55 (27%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPPP P PPP P PP PP Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPP---PXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PPK K PP P P P P P P K P PP Sbjct: 50 PPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPK 109 Query: 659 PAPXPXP 679 PAP P P Sbjct: 110 PAPAPAP 116 Score = 30.7 bits (66), Expect = 1.4 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPK K PP P P P P P P K P PP PAP Sbjct: 28 PPKPKPAPAPTPPKPKPT------PAPTPP--KPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Query: 668 XPXP 679 P P Sbjct: 80 APTP 83 Score = 29.5 bits (63), Expect = 3.2 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPK K P PP P P P P P P P P PAP Sbjct: 72 PPKPKPAPA-PTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP----APAPTPAPKPKPAP 126 Query: 668 XPXP 679 P P Sbjct: 127 KPAP 130 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 33.1 bits (72), Expect = 0.26 Identities = 22/69 (31%), Positives = 23/69 (33%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G G G GGGG G G G G GGGGGG Sbjct: 208 GYGGGGGGGSGGGGAYGGGGAHGGGYG----SGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Query: 498 FFGGXXXGG 472 +GG GG Sbjct: 264 SYGGEHGGG 272 Score = 29.5 bits (63), Expect = 3.2 Identities = 21/69 (30%), Positives = 22/69 (31%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G GAG GGG G G G G G GGGG Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGG--EGGGAGGGGSHGGAG 207 Query: 498 FFGGXXXGG 472 +GG GG Sbjct: 208 GYGGGGGGG 216 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGG 636 G GG AGGG G GGGG Sbjct: 111 GYGGAAGGHAGGGGGGSGGGGG 132 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGGVXXFXXXRXXXXGXXXXXXXXXXXXXXXXXXXXGGGGG 522 G GG +GGG G G GG G GGGGG Sbjct: 118 GHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGG 177 Query: 521 G 519 G Sbjct: 178 G 178 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGGVXXFXXXRXXXXGXXXXXXXXXXXXXXXXXXXXGGGGG 522 G GG GGG G GGGG G GGGGG Sbjct: 156 GASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGG 215 Query: 521 G 519 G Sbjct: 216 G 216 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/67 (29%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP K PP PP P P P P K P PPP Sbjct: 104 PPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPC 163 Query: 659 PAPXPXP 679 P P P P Sbjct: 164 PPPTPTP 170 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/62 (27%), Positives = 17/62 (27%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP K P PP P P P P P P PP P P Sbjct: 141 PPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTP 200 Query: 668 XP 673 P Sbjct: 201 TP 202 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP K PPP P P P P P P P PP P P Sbjct: 153 PPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVI--TPPTPTPPVVTPPTPTPPVITPPTP 210 Query: 668 XP 673 P Sbjct: 211 TP 212 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPX-PXPFXXKXPXXPP-PPXXXP 661 PP K P P P P P P P P K P P PP P Sbjct: 99 PPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKP 158 Query: 662 APXPXP 679 P P P Sbjct: 159 PPTPCP 164 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 32.7 bits (71), Expect = 0.34 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP-FXXKXPXXPPPPXXXPA 664 PP P PPPP P P P P P P PP P Sbjct: 32 PPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPK 91 Query: 665 PXPXP 679 P P P Sbjct: 92 PLPPP 96 Score = 32.7 bits (71), Expect = 0.34 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PPK PP PPPP P PL P P P PP Sbjct: 89 PPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPL-----SPPPPAITPPPPLATTPPALP 143 Query: 659 PAPXPXP 679 P P P P Sbjct: 144 PKPLPPP 150 Score = 31.1 bits (67), Expect = 1.0 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +1 Query: 523 PPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXXP 702 PPPPP P S PPPP P PPPA P P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLS--PPQTTPPPPPAITPPPPPAITPPLSPPP 126 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPP 684 PPPP P PPPA P Sbjct: 272 PPPPQTTPPPPPAITP 287 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/54 (33%), Positives = 18/54 (33%), Gaps = 2/54 (3%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPP--PPXXXPAPXP 673 PPPPP P A P P P P PP PP P P P Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALP---PKPLPPPLSPPQTTPPPPP 162 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXP--XXPPPPXXXPAPXP 673 PPPPP P P P P F P PPPP +P P Sbjct: 31 PPPPPCICICNPGPPPPQP---DPQPPTPPTFQPAPPANDQPPPPPQSTSPPP 80 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 32.7 bits (71), Expect = 0.34 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = +2 Query: 524 PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPP P +P G P P+ P PPPP P+P Sbjct: 202 PPPPYVYSFPPPPPYYSPSPKVGYKSPPAPYVYSSP--PPPPYYSPSP 247 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 524 PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPP P +P P P+ P PPPP P+P Sbjct: 366 PPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSP--PPPPYYSPSP 411 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 524 PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPP P +P P P+ P PPPP P+P Sbjct: 150 PPPPYIYSSPPPPPYYSPSPKVDYKSPPPPYVYSSP--PPPPYYSPSP 195 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/57 (29%), Positives = 20/57 (35%), Gaps = 3/57 (5%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPX---PFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP + P + P P PF PPPP +P P P Sbjct: 349 PPPPPYYSPSPTVNYKSPPPPYVYNSPPPPPYYSPFPKVEYKSPPPPYIYNSPPPPP 405 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 524 PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPP P +P P P+ P PPPP P+P Sbjct: 176 PPPPYVYSSPPPPPYYSPSPKVEYKSPPPPYVYSFP--PPPPYYSPSP 221 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 32.7 bits (71), Expect = 0.34 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP P P P P PF P PPP +P Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRP----PYVYKS--PPPPPFVYSSP--PPPTYIYNSP 116 Query: 668 XPXP 679 P P Sbjct: 117 PPPP 120 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 32.3 bits (70), Expect = 0.45 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 4/68 (5%) Frame = +2 Query: 488 PPKKKXXXXXPPP----PPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXX 655 PP PPP PPP P P P P P + P PPPP Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP-TPEAPCPPPPPTP 171 Query: 656 XPAPXPXP 679 P P P P Sbjct: 172 YP-PPPKP 178 Score = 30.3 bits (65), Expect = 1.8 Identities = 20/65 (30%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PP PPPP P P P P P PPPP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPP-----PPPTPYTPPPPTPYTPPPPTVK 144 Query: 659 PAPXP 673 P P P Sbjct: 145 PPPPP 149 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/64 (28%), Positives = 19/64 (29%), Gaps = 1/64 (1%) Frame = +2 Query: 491 PKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP-FXXKXPXXPPPPXXXPAP 667 P K PP PP P P P P + K P PPP P Sbjct: 38 PVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Query: 668 XPXP 679 P P Sbjct: 98 PPPP 101 Score = 29.1 bits (62), Expect = 4.2 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPP 684 TPPPP P PPP P Sbjct: 137 TPPPPTVKPPPPPVVTP 153 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/56 (32%), Positives = 19/56 (33%), Gaps = 2/56 (3%) Frame = +2 Query: 518 PPPP--PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPP P P P P P P+ PPPP P P P P Sbjct: 76 PPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYV----KPPPPPTVKPPPPPTP 127 Score = 27.9 bits (59), Expect = 9.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPP P P P P P P PP P P P Sbjct: 78 PPYTPKPPTVKPPPPPYVKPPP--PPTVKPPPPPYVKPPPPPTV--KPPPPPTPYTPPPP 133 Query: 668 XP 673 P Sbjct: 134 TP 135 Score = 27.9 bits (59), Expect = 9.7 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P P P P+ P PPP P P P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPP--PVVTPPP 155 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP P P Sbjct: 106 PPPPYVKPPPPPTVKPPPPPTP 127 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/64 (29%), Positives = 22/64 (34%), Gaps = 2/64 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXP--PPPXXXP 661 PP + PPPPP P P++ P P P P PPP P Sbjct: 44 PPPYRSPVTIPPPPPVYSRPVAFPP--PPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Query: 662 APXP 673 P P Sbjct: 102 PPTP 105 Score = 30.7 bits (66), Expect = 1.4 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP P PPP PP P Sbjct: 68 PPPPIYSPPPPPIYPPPIYSPP 89 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/61 (26%), Positives = 16/61 (26%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPPP P PPP P PPP PP Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSP 101 Query: 700 P 702 P Sbjct: 102 P 102 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/65 (29%), Positives = 19/65 (29%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPP P P P F PPPP P P Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPP 83 Query: 668 -XPXP 679 P P Sbjct: 84 LVPDP 88 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP G P F P P P P P P P Sbjct: 36 PPPSHQPYSYPPPPPP-PPHAYYQQGPHYPQFNQLQAPPPPPPPSAPPPLVPDPPRHQGP 94 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/64 (28%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPPP + +P P P P PPP P+ Sbjct: 58 PPPLSLSPSSPPPPPPSSSPLSSLSPSLSP-SPPSSSPSSAPPSSLSPSSPPPLSLSPSS 116 Query: 668 XPXP 679 P P Sbjct: 117 PPPP 120 Score = 29.1 bits (62), Expect = 4.2 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPPP P +PPP P PP PP Sbjct: 68 PPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPP 122 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 31.5 bits (68), Expect = 0.79 Identities = 20/69 (28%), Positives = 23/69 (33%), Gaps = 5/69 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXA-----PLFXXGXXPXPXPFXXKXPXXPPPPX 652 PP + P PPPP P + P F P P P+ P PP P Sbjct: 13 PPSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHP-PPPSPY 71 Query: 653 XXPAPXPXP 679 P P P Sbjct: 72 PHPHQPPPP 80 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 31.5 bits (68), Expect = 0.79 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 599 PXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P P P PPPP P P P P Sbjct: 265 PPPPPAAAPPPQPPPPPPPKPQPPPPP 291 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PP PP P P P P + P PPPP P P Sbjct: 57 PPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP PP P P P P + P PPPP P P P Sbjct: 64 PPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPP 116 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +2 Query: 530 PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPP-PXXXPAPXPXP 679 PP P PL P P P P PPP P P P P Sbjct: 20 PPGTTGTCCPPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFPALFPPEPPLP 70 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 31.5 bits (68), Expect = 0.79 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP 613 PPKK PPPPPP GA P P P Sbjct: 627 PPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPPVPPP 668 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 31.5 bits (68), Expect = 0.79 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 2/52 (3%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXP--XXPPPPXXXPAP 667 PPP PP P +P P P P P PPPP P P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPP 634 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/65 (30%), Positives = 22/65 (33%), Gaps = 3/65 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPP---PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP+ PP P PP P +P P P P P PPPP Sbjct: 535 PPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPP-PVASPPPPSPPPPVHS 593 Query: 659 PAPXP 673 P P P Sbjct: 594 PPPPP 598 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 P PP P P S +PPPP P PPP+ PP Sbjct: 536 PQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP-PPPSPPPPVHSP 594 Query: 700 P 702 P Sbjct: 595 P 595 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/54 (27%), Positives = 16/54 (29%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P P PP P P P P + P PPP P P P Sbjct: 541 PSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSP 594 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/61 (27%), Positives = 19/61 (31%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPP PP + P S +PPPP P PP PP Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPS----PVYSPPPPSHSPPPPVYSPPPPTFS 638 Query: 700 P 702 P Sbjct: 639 P 639 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 31.1 bits (67), Expect = 1.0 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PP +K PPPPPP PL P P P K P PPPP Sbjct: 303 PPPQKSIPPPPPPPPP-------------PLLQQ---PPPPPSVSKAPPPPPPP 340 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PPPPPP PG+ + P P PPPP Sbjct: 74 PPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPP 117 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 31.1 bits (67), Expect = 1.0 Identities = 16/57 (28%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 521 PPPPPXXXXXXXXP----GAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P + P + P P + P P PP P P P Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPP 540 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/52 (30%), Positives = 20/52 (38%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPP + P + P P P+ P PPPP +P P Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYS-SPPPPPYVYSSP--PPPPYVYSSPPP 506 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP-----FXXKXPXXPPP-PXXXPAPXPXP 679 PPP P P +PL+ P P P + P PPP P P P P Sbjct: 598 PPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSP 657 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/60 (28%), Positives = 21/60 (35%), Gaps = 6/60 (10%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXP-----FXXKXPXXPPP-PXXXPAPXPXP 679 PPP P P +P++ P P P + P PPP P P P P Sbjct: 583 PPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSP 642 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/61 (26%), Positives = 17/61 (27%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXX 699 PPPP P P +PPPP P PP PP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 801 Query: 700 P 702 P Sbjct: 802 P 802 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPP---PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PPPP PP P +P P P PPPP Sbjct: 742 PPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHS 801 Query: 659 PAPXPXP 679 P P P P Sbjct: 802 P-PPPSP 807 Score = 29.1 bits (62), Expect = 4.2 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 3/55 (5%) Frame = +2 Query: 518 PPPPP---PXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPP P P +P P P PPPP P P P Sbjct: 684 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 28.7 bits (61), Expect = 5.6 Identities = 20/83 (24%), Positives = 21/83 (25%), Gaps = 3/83 (3%) Frame = +1 Query: 520 PPP---PPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPPXX 690 PPP PPP P +PPPP P PP PP Sbjct: 664 PPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 723 Query: 691 XXXPXXXXXXXXXXXXXXXPPAA 759 P PP A Sbjct: 724 VHSPPPPVQSPPPPPVFSPPPPA 746 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/65 (27%), Positives = 19/65 (29%), Gaps = 3/65 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PP PPPP P +P P P P PPP Sbjct: 727 PPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVH 786 Query: 659 PAPXP 673 P P Sbjct: 787 SPPPP 791 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/54 (29%), Positives = 17/54 (31%) Frame = +1 Query: 523 PPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPP P S +PPPP P PP PP Sbjct: 751 PPPPPVHSPPPPVHSPPPPPVHSPPPPVHS-PPPPVHSPPPPVHSPPPPVHSPP 803 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/48 (27%), Positives = 14/48 (29%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXP 777 +PPPP P PP PP P PP P Sbjct: 655 SPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/48 (27%), Positives = 14/48 (29%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPAARGXAXP 777 +PPPP P PP PP P PP P Sbjct: 662 SPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPP 709 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXP-GAXAPLFXXGXXPXPXP 613 PP+ K PPPPPP P + P G P P P Sbjct: 228 PPQVKQSEPTPPPPPPSIAVKQSAPTPSPPPPIKKGSSPSPPP 270 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 30.3 bits (65), Expect = 1.8 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPP 684 +PPPP P PPP PP Sbjct: 54 SPPPPSCTPSPPPPSPP 70 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PP PPP P + P P P P P PPPP Sbjct: 52 PPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLP----PPPPPPPP 91 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P P P P K PP P P P P P Sbjct: 49 PPPPPSPPPPSCTPSP----------PPPSPPPPKKSSCPPSPLPPPPPPPPP 91 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/51 (31%), Positives = 18/51 (35%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPP +P+ P P P PPPP P P P Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRSPPPLQ---TPPPPPPPPPLAPPPPP 394 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = +1 Query: 640 PPPXXXPXPPPAXPPXXXXXP 702 PPP P PPP PP P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPP 393 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPP P +P P P PPPP P P P P Sbjct: 550 PPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSP-PPPAP 601 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 2/63 (3%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXX--TPPPPXXXPXPPPAXPPXXX 693 PPPPPP P + +PPPP P PP PP Sbjct: 534 PPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPV 593 Query: 694 XXP 702 P Sbjct: 594 HSP 596 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 2/66 (3%) Frame = +2 Query: 488 PPKKKXXXXXPPPP--PPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP 661 PP PPPP P P +P P P P P PP P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPP 617 Query: 662 APXPXP 679 P P Sbjct: 618 VYSPPP 623 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPP-PXXXPXPPPAXPP 684 PPPPPP P S PPP P P PP PP Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPP 613 Score = 28.3 bits (60), Expect = 7.4 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 7/67 (10%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXP----XXPPP 646 PP PP PPPP P +P P P P P PPP Sbjct: 518 PPPAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPP 577 Query: 647 PXXXPAP 667 P P P Sbjct: 578 PVYSPPP 584 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 3/65 (4%) Frame = +2 Query: 488 PPKKKXXXXXPP---PPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXX 658 PP PP PPPP P +P P P PPPP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPV 602 Query: 659 PAPXP 673 +P P Sbjct: 603 HSPPP 607 Score = 27.9 bits (59), Expect = 9.7 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXPXXXXXXXXXXXXXXXPPA 756 PPPP P PP PP P PPA Sbjct: 561 PPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPA 600 Score = 27.9 bits (59), Expect = 9.7 Identities = 18/68 (26%), Positives = 20/68 (29%), Gaps = 4/68 (5%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXP-- 661 PP PPPP P P P P + P PPP P Sbjct: 577 PPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPPPVYSPPPPVFSPPPSQSPPV 636 Query: 662 --APXPXP 679 +P P P Sbjct: 637 VYSPPPRP 644 >At3g24650.1 68416.m03095 abscisic acid-insensitive protein 3 (ABI3) identical to abscisic acid-insensitive protein 3 GI:16146 SP:Q01593 from [Arabidopsis thaliana], (Plant Cell 4 (10), 1251-1261 (1992)) Length = 720 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/49 (32%), Positives = 16/49 (32%), Gaps = 1/49 (2%) Frame = +2 Query: 524 PPPPXXXXXXXXPG-AXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PPPP PG P P P P PPPP P P Sbjct: 355 PPPPQQQAFVSDPGFGYMPAPNYPPQPEFLPLLESPPSWPPPPQSGPMP 403 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/64 (28%), Positives = 19/64 (29%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPP P PG+ P P P K P P PP Sbjct: 210 PPSDSEHPSPPPPGHPKRREQPPPPGSKRP-----TPSPPSPSDSKRPVHPSPPSPPEET 264 Query: 668 XPXP 679 P P Sbjct: 265 LPPP 268 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLF--XXGXXPXPXPFXXKXPXXP---PPPX 652 PP + PP P P P P+ P P P P P PPP Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPE 121 Query: 653 XXPAPXP 673 P P P Sbjct: 122 SSPPPPP 128 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPP P P + P P P P P P P P P Sbjct: 100 PPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPP 151 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/64 (28%), Positives = 20/64 (31%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPP P P P++ P P P PPP P Sbjct: 759 PPPPTVHYNPPPPPSPAHYSPPPSP----PVYYYNSPPPPPAVHYSPP--PPPVIHHSQP 812 Query: 668 XPXP 679 P P Sbjct: 813 PPPP 816 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 5/59 (8%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXX-----GXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 P PP P PG +P G P P P P PP P P P Sbjct: 559 PSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSPP 617 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/64 (29%), Positives = 21/64 (32%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP PPPPP P + P P P P P PP P +P Sbjct: 724 PPPTPTYHYISPPPPPT-PIHSPPPQSHPPCIEYS--PPPPPTVHYNPPPPPSPAHY-SP 779 Query: 668 XPXP 679 P P Sbjct: 780 PPSP 783 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/67 (26%), Positives = 20/67 (29%), Gaps = 3/67 (4%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP---XXX 658 PP P PPP P A P+ P P PP P Sbjct: 63 PPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTPSTSPSPLTVPDMPSPPMPSGMESS 122 Query: 659 PAPXPXP 679 P+P P P Sbjct: 123 PSPGPMP 129 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = -2 Query: 672 GXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGG 517 G G+G GGGG G G G GGGGGG Sbjct: 146 GGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGG 197 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -3 Query: 683 GGXAGGGXGXXXGGGGV 633 GG GGG G GGGGV Sbjct: 191 GGGGGGGGGGGGGGGGV 207 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXG 598 G G G G GGGG G G G G Sbjct: 193 GGGGGGGGGGGGGGVDGSGSGSGSGSG 219 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 26.6 bits (56), Expect(2) = 3.7 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +1 Query: 637 PPPPXXXPXPPPA 675 PPPP P PPPA Sbjct: 46 PPPPPRPPPPPPA 58 Score = 21.0 bits (42), Expect(2) = 3.7 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +1 Query: 520 PPPPPP 537 PPPPPP Sbjct: 44 PPPPPP 49 >At5g22560.1 68418.m02635 hypothetical protein contains Pfam profile PF03140: Plant protein of unknown function Length = 517 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 605 PXPFXXKXPXXPPPPXXXPAPXPXP 679 P P K P PPPP P P P Sbjct: 299 PPPIETKTPPLPPPPPTLTQPHPKP 323 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 29.1 bits (62), Expect = 4.2 Identities = 20/69 (28%), Positives = 21/69 (30%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G G G GG G G G G G K + GGGG G Sbjct: 64 GGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGG 123 Query: 498 FFGGXXXGG 472 G GG Sbjct: 124 VGAGGGAGG 132 Score = 27.9 bits (59), Expect = 9.7 Identities = 21/77 (27%), Positives = 21/77 (27%) Frame = -3 Query: 866 GXGXGXXGGXXGXXXXXXXXXXXXXXXXXXGXAXPRAAGGXXXXXXXXXXXXGXXGXXXX 687 G G GG G G AGG G G Sbjct: 107 GRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVGGGGKGRGGK 166 Query: 686 XGGXAGGGXGXXXGGGG 636 GG AGGG G G GG Sbjct: 167 SGGGAGGGVGGGVGAGG 183 Score = 27.9 bits (59), Expect = 9.7 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = -3 Query: 866 GXGXGXXGGXXGXXXXXXXXXXXXXXXXXXGXAXPRAAGGXXXXXXXXXXXXGXXGXXXX 687 G G GG G G A A+GG G G Sbjct: 364 GAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVG 423 Query: 686 XGGXAGGGXGXXXGGG 639 GG GGG G GGG Sbjct: 424 AGGGVGGGVGGGVGGG 439 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/53 (30%), Positives = 17/53 (32%), Gaps = 2/53 (3%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXAPLF--XXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPP P P P P P P PPP +P P Sbjct: 68 PPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPP 120 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/69 (27%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +2 Query: 488 PPKKKXXXXXPPP-----PPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPX 652 PP PPP PPP + P P P + P PPPP Sbjct: 86 PPSSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPAD-EDESPPAPPPPE 144 Query: 653 XXPAPXPXP 679 P P P Sbjct: 145 QLPPPASSP 153 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/55 (27%), Positives = 16/55 (29%) Frame = +1 Query: 520 PPPPPPXXLXXXXXXXXXXXXXXXXXPXXXSLXXXXXXTPPPPXXXPXPPPAXPP 684 PPPPPP + T PP P PPP PP Sbjct: 255 PPPPPPVEVPQKPRRTHRSVRNRDLQENAKRSETKFKRTFQPPPSPPPPPPPPPP 309 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PPPPPP LF G P PPPP Sbjct: 386 PPPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPPP 429 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = +2 Query: 497 KKXXXXXPPPPPPXXXXXXXXPGAX--APLFXXGXXPXPXPFXXKXPXXPPPPXXXP-AP 667 KK PP P P P AP G P P K P PPP P AP Sbjct: 365 KKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP 424 Query: 668 XP 673 P Sbjct: 425 RP 426 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 28.7 bits (61), Expect = 5.6 Identities = 21/62 (33%), Positives = 21/62 (33%), Gaps = 3/62 (4%) Frame = +2 Query: 497 KKXXXXXPPPPPPXXXXXXXXPGAX--APLFXXGXXPXPXPFXXKXPXXPPPPXXXP-AP 667 KK PP P P P AP G P P K P PPP P AP Sbjct: 365 KKASAPPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAP 424 Query: 668 XP 673 P Sbjct: 425 RP 426 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/44 (29%), Positives = 15/44 (34%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PPPPP A + P P + P PPPP Sbjct: 169 PPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPPPP 212 >At5g03160.1 68418.m00264 DNAJ heat shock N-terminal domain-containing protein similar to P58 protein, Bos primigenius taurus, PIR:A56534; similar to p58 (GI:1353270) {Homo sapiens}; contains Pfam PF00226: DnaJ domain; contains Pfam PF00515: TPR Domain Length = 482 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -2 Query: 534 GGGGGGXXXXFFFFGGXXXGG 472 GGGGGG F F GG GG Sbjct: 454 GGGGGGQQYTFHFEGGFPGGG 474 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/54 (29%), Positives = 16/54 (29%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP PPP P P P P P PPP P P P Sbjct: 418 PPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPSP 471 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPPPP P P P P P P PPP +P P P Sbjct: 411 PPPPPP--SPPLPPPVYSPPPSPPVFSPPPSPPVYSPP--PPPSIHYSSPPPPP 460 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/54 (35%), Positives = 19/54 (35%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGG 517 G G G G GGGG G G G G K GGGGGG Sbjct: 6 GSGSGGGGKGGGGGGSGGGRGGGGGGG--------AKGGCGGGGKSGGGGGGGG 51 >At4g29240.1 68417.m04182 leucine-rich repeat family protein / extensin family protein contains Pfam PF00560: Leucine Rich Repeat domains; similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana] Length = 415 Score = 23.8 bits (49), Expect(2) = 6.4 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = -2 Query: 534 GGGGGGXXXXFFFFGGXXXGG 472 GGGGGG + GG GG Sbjct: 41 GGGGGGGGGGVWVGGGYNNGG 61 Score = 23.0 bits (47), Expect(2) = 6.4 Identities = 9/17 (52%), Positives = 9/17 (52%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXG 628 G G G G GGGG G Sbjct: 31 GVGGGVGVGIGGGGGGG 47 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/62 (27%), Positives = 19/62 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP+ PPPP PG P + P P PPPP P Sbjct: 162 PPQPPFAGQGGPPPP--YGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGP 219 Query: 668 XP 673 P Sbjct: 220 PP 221 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/54 (27%), Positives = 15/54 (27%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PPPP P P P P P P P P P P P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSP 141 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGG 636 G GG AGGG G GGGG Sbjct: 15 GGGGGHGGGAGGGFGGGAGGGG 36 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +1 Query: 637 PPPPXXXPXPPPAXPPXXXXXP 702 PPPP PPP+ PP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPP 85 >At3g10525.1 68416.m01263 expressed protein Length = 128 Score = 28.3 bits (60), Expect = 7.4 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXP 681 +PPPP P PPP+ P Sbjct: 57 SPPPPPRKPRPPPSAP 72 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 28.3 bits (60), Expect = 7.4 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -3 Query: 314 GXPPSXGXVXGXGGXXXXFXGGNXXPGNXNXFXPKXPXXXGGGVPNPPKTLXGXXGPPGS 135 G P + G G GG G PGN N K GGG P K G GP Sbjct: 259 GAPAAGGG--GAGGGKGAGGGAKGGPGNQNQGGGKN---GGGGHPQDGKNGGGGGGPNAG 313 Query: 134 K 132 K Sbjct: 314 K 314 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXP 589 G G GAG GGGG G G G P Sbjct: 164 GGGAGAGSALGGGGAGAGPALGGGGAGAGP 193 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/55 (29%), Positives = 18/55 (32%), Gaps = 1/55 (1%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA-PXPXP 679 PPP PP + P+ P P P P P PA P P P Sbjct: 96 PPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAP 150 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPL 580 PP KK PPPPP PG P+ Sbjct: 83 PPPKKVSSYCPPPPPANFLYITGPPGNLYPV 113 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/65 (27%), Positives = 20/65 (30%), Gaps = 1/65 (1%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXX-PGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPA 664 PP PPP PP P +P+ P P P PPP Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVI----PFPKPQLPPPSLFPPPSLVNQL 137 Query: 665 PXPXP 679 P P P Sbjct: 138 PDPRP 142 Score = 27.9 bits (59), Expect = 9.7 Identities = 19/57 (33%), Positives = 19/57 (33%), Gaps = 4/57 (7%) Frame = +2 Query: 521 PPPPPXXXXXXXXPGAXA----PLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXPXP 679 PP PP P A A P P P P P PPP P P P P Sbjct: 48 PPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPSSPPPSITPPP-SPPQPQPPP 103 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 27.9 bits (59), Expect = 9.7 Identities = 20/69 (28%), Positives = 22/69 (31%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G G+ G GG G G G G G GGGG F Sbjct: 346 GGGYGSSGIGGYGGGMG-----GAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSF 400 Query: 498 FFGGXXXGG 472 + GG GG Sbjct: 401 YGGGGGRGG 409 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 27.9 bits (59), Expect = 9.7 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAP 667 PP P PP P P PL P P P PPPP P P Sbjct: 307 PPTLPTIPLLPTPPTPTLPPIPTIP-TLPPLPVLPPVPIVNP-----PSLPPPPPSFPVP 360 Query: 668 XP 673 P Sbjct: 361 LP 362 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 27.9 bits (59), Expect = 9.7 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPP 684 +PPP P PPP+ PP Sbjct: 422 SPPPSPVQPPPPPSPPP 438 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 27.9 bits (59), Expect = 9.7 Identities = 19/69 (27%), Positives = 21/69 (30%) Frame = -2 Query: 678 GXGXGAGXXXGGGGXXGXXXXKGXGXGXXPXXXXXXXXXXXXKXKXXXGGGGGGXXXXFF 499 G G G G GGG G G G G + GGGG Sbjct: 98 GGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGG 157 Query: 498 FFGGXXXGG 472 + GG GG Sbjct: 158 YGGGGGYGG 166 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 634 TPPPPXXXPXPPPAXPPXXXXXP 702 +PPPP P PPP P P Sbjct: 46 SPPPPPSNPSPPPPSPTTTACPP 68 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 27.9 bits (59), Expect = 9.7 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 598 PXXXSLXXXXXXTPPPPXXXPXPPPAXPPXXXXXP 702 P L PPP P PPP PP P Sbjct: 12 PLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGP 46 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPP P P + P P P P PPP P P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVA-SPPPATPPPVATPPPAP 115 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 27.9 bits (59), Expect = 9.7 Identities = 15/52 (28%), Positives = 16/52 (30%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPP P P + P P P P PPP P P P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVA-SPPPATPPPVATPPPAP 115 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = -1 Query: 535 GGGGGGXXXXXFFFWGGXXGG 473 GGGGGG + WGG GG Sbjct: 81 GGGGGGGGGGGGWGWGGGGGG 101 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 27.9 bits (59), Expect = 9.7 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 701 GXXXXXGGXAGGGXGXXXGGGGV 633 G GG GGG G GGGG+ Sbjct: 144 GGLGWDGGNGGGGPGYGSGGGGI 166 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 27.9 bits (59), Expect = 9.7 Identities = 17/54 (31%), Positives = 17/54 (31%), Gaps = 2/54 (3%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAP--LFXXGXXPXPXPFXXKXPXXPPPPXXXPAPXP 673 PPPPPP P P L G P P P K P P P Sbjct: 245 PPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPAP 298 Score = 27.9 bits (59), Expect = 9.7 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 488 PPKKKXXXXXPPPPPP 535 PPK K PPPPPP Sbjct: 264 PPKLKNNGPSPPPPPP 279 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 27.9 bits (59), Expect = 9.7 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 518 PPPPPPXXXXXXXXPGAXAPLFXXGXXPXPXPFXXKXPXXPPPP 649 PPPPPP P P P P + PPPP Sbjct: 195 PPPPPPGNAAIPVEPPLTMSAEKESYAPLPPP-PGRAALPPPPP 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.315 0.154 0.546 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,850,968 Number of Sequences: 28952 Number of extensions: 283741 Number of successful extensions: 7801 Number of sequences better than 10.0: 84 Number of HSP's better than 10.0 without gapping: 754 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3862 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2129873112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -