BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N21 (911 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical pr... 29 6.1 AF098986-1|AAC67425.1| 747|Caenorhabditis elegans T box family ... 28 8.1 >Z68338-7|CAA92756.2| 866|Caenorhabditis elegans Hypothetical protein T24B8.4 protein. Length = 866 Score = 28.7 bits (61), Expect = 6.1 Identities = 17/51 (33%), Positives = 18/51 (35%) Frame = +2 Query: 521 PXXPXPXXXPPXXPXXXXXYPRPPDSPFXXGLXXXPXMIXXP*WSLDHPPP 673 P P P PP P P PP P G+ P M P PPP Sbjct: 75 PPPPGPGGIPPPPPMFAGGIPPPP--PMMGGIPPPPPMFGAP----PPPPP 119 >AF098986-1|AAC67425.1| 747|Caenorhabditis elegans T box family protein 31 protein. Length = 747 Score = 28.3 bits (60), Expect = 8.1 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -3 Query: 381 YILKLTSRLNNTSIYGSRFKDHFPIALAEPRTSIAGPALTMP 256 ++L L+ L S Y K HFP TS+ GPA+ +P Sbjct: 612 HLLNLSHHLCRFSEYNLFVKAHFPRGSYGSLTSMTGPAVEIP 653 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,789,295 Number of Sequences: 27780 Number of extensions: 268641 Number of successful extensions: 1049 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 706 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 935 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2328783996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -