BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N17 (888 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 24 1.6 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 22 6.5 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 6.5 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 6.5 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 22 6.5 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 6.5 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 22 8.6 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 24.2 bits (50), Expect = 1.6 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -1 Query: 171 FLTILRREAP*RVPYLPVIP 112 FL ++ P VPY PVIP Sbjct: 639 FLVVISSSNPLNVPYGPVIP 658 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +3 Query: 705 SPXKXXPPPPP 737 +P K PPPPP Sbjct: 337 TPPKPAPPPPP 347 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 91 GQTYQKGWNYWQIWHTL 141 G+ W+Y+ I+HTL Sbjct: 165 GKNITTPWDYYYIYHTL 181 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 91 GQTYQKGWNYWQIWHTL 141 G+ W+Y+ I+HTL Sbjct: 180 GKNITTPWDYYYIYHTL 196 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 91 GQTYQKGWNYWQIWHTL 141 G+ W+Y+ I+HTL Sbjct: 68 GKNITTPWDYYYIYHTL 84 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 6.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = -1 Query: 138 RVPYLPVIPTFLVRLAILVNLSDTKVDREKKNKS 37 R+P LP+IP + V + + + + REK + S Sbjct: 784 RIPILPMIPVYCVPVPQVNDSTILSPVREKLSSS 817 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.8 bits (44), Expect = 8.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 265 SLTRPDADTRTFHSILTTK*ASILCVL 185 + TRP T TFH IL K A+ L VL Sbjct: 334 TFTRPCGITLTFHEIL--KRANTLFVL 358 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 203,408 Number of Sequences: 438 Number of extensions: 4407 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28662543 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -