BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N16 (934 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071295-1|AAL48917.1| 227|Drosophila melanogaster RE32624p pro... 30 5.2 AE014134-2694|AAF53519.1| 227|Drosophila melanogaster CG5861-PA... 30 5.2 >AY071295-1|AAL48917.1| 227|Drosophila melanogaster RE32624p protein. Length = 227 Score = 29.9 bits (64), Expect = 5.2 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -3 Query: 362 LKNYFSGFRCFR--GLQIFIKFVEAVYHRTKVFLNSLRGQGGFNFFPQFLNC 213 L Y + ++C + G+ IF + V+ + T + ++ G FNFF + L C Sbjct: 25 LSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSSSGEFNFFAEILRC 76 >AE014134-2694|AAF53519.1| 227|Drosophila melanogaster CG5861-PA protein. Length = 227 Score = 29.9 bits (64), Expect = 5.2 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -3 Query: 362 LKNYFSGFRCFR--GLQIFIKFVEAVYHRTKVFLNSLRGQGGFNFFPQFLNC 213 L Y + ++C + G+ IF + V+ + T + ++ G FNFF + L C Sbjct: 25 LSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSSSGEFNFFAEILRC 76 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,516,161 Number of Sequences: 53049 Number of extensions: 470748 Number of successful extensions: 1313 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1309 length of database: 24,988,368 effective HSP length: 85 effective length of database: 20,479,203 effective search space used: 4607820675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -