BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N13 (956 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 54 1e-07 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 48 9e-06 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 47 2e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 46 3e-05 At1g61080.1 68414.m06877 proline-rich family protein 45 6e-05 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 44 2e-04 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 44 2e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 43 3e-04 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 42 5e-04 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 40 5e-04 At5g46730.1 68418.m05757 glycine-rich protein 42 8e-04 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 42 8e-04 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 42 8e-04 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 42 8e-04 At2g30560.1 68415.m03722 glycine-rich protein 42 8e-04 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 35 0.001 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 41 0.001 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 41 0.001 At4g01985.1 68417.m00265 expressed protein 40 0.002 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 40 0.002 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 40 0.002 At1g70990.1 68414.m08190 proline-rich family protein 33 0.003 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 40 0.003 At1g62240.1 68414.m07021 expressed protein 40 0.003 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 33 0.003 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 39 0.004 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 39 0.004 At1g75550.1 68414.m08780 glycine-rich protein 39 0.004 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 39 0.006 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 39 0.006 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 39 0.006 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 34 0.009 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 38 0.010 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 38 0.010 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 38 0.013 At4g30460.1 68417.m04325 glycine-rich protein 37 0.017 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 37 0.017 At3g51290.1 68416.m05614 proline-rich family protein 37 0.017 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 37 0.017 At1g27710.1 68414.m03387 glycine-rich protein 37 0.017 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 37 0.023 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 37 0.023 At1g10620.1 68414.m01204 protein kinase family protein contains ... 37 0.023 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 36 0.030 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 36 0.030 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 36 0.030 At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / he... 36 0.030 At2g28670.1 68415.m03485 disease resistance-responsive family pr... 36 0.030 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 36 0.030 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 36 0.040 At1g29380.1 68414.m03592 hypothetical protein 36 0.040 At1g02710.1 68414.m00222 glycine-rich protein 36 0.040 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 36 0.053 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 36 0.053 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 36 0.053 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 36 0.053 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 36 0.053 At1g13020.1 68414.m01510 eukaryotic translation initiation facto... 36 0.053 At3g50180.1 68416.m05486 hypothetical protein 35 0.069 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 35 0.069 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 35 0.069 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 35 0.069 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 35 0.069 At2g05440.2 68415.m00575 glycine-rich protein 35 0.069 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 35 0.069 At1g26150.1 68414.m03192 protein kinase family protein similar t... 35 0.069 At4g18570.1 68417.m02749 proline-rich family protein common fami... 35 0.092 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 35 0.092 At1g53625.1 68414.m06096 expressed protein 35 0.092 At1g49270.1 68414.m05524 protein kinase family protein contains ... 35 0.092 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 34 0.12 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 34 0.12 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 34 0.12 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 34 0.12 At1g15830.1 68414.m01900 expressed protein 34 0.12 At1g11850.2 68414.m01364 expressed protein 34 0.12 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 31 0.14 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 34 0.16 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 34 0.16 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 34 0.16 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 34 0.16 At3g50140.1 68416.m05481 expressed protein contains Pfam profile... 34 0.16 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 34 0.16 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 34 0.16 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 34 0.16 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 34 0.16 At4g33660.1 68417.m04781 expressed protein 33 0.21 At4g16240.1 68417.m02464 hypothetical protein 33 0.21 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 33 0.21 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.21 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 33 0.21 At2g05440.1 68415.m00574 glycine-rich protein 33 0.21 At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containi... 33 0.21 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 32 0.28 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 33 0.28 At2g35920.1 68415.m04409 helicase domain-containing protein simi... 33 0.28 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 33 0.28 At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein /... 29 0.30 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 33 0.37 At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1... 33 0.37 At2g05510.1 68415.m00583 glycine-rich protein 33 0.37 At4g21720.1 68417.m03145 expressed protein 30 0.43 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 0.48 At5g38560.1 68418.m04662 protein kinase family protein contains ... 32 0.49 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 32 0.49 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 32 0.49 At4g08230.1 68417.m01358 glycine-rich protein 32 0.49 At3g24550.1 68416.m03083 protein kinase family protein contains ... 32 0.49 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 32 0.49 At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identica... 32 0.49 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 32 0.49 At3g55950.1 68416.m06217 protein kinase family protein contains ... 25 0.63 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 32 0.65 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 32 0.65 At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ b... 32 0.65 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 31 0.86 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 0.86 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 31 0.86 At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family prot... 31 0.86 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 0.86 At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TO... 31 0.86 At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TO... 31 0.86 At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TO... 31 0.86 At3g11402.1 68416.m01388 DC1 domain-containing protein contains ... 31 0.86 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 0.86 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 31 0.86 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 31 0.86 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 31 1.1 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 31 1.1 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 31 1.1 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 31 1.1 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 31 1.1 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 31 1.1 At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein... 31 1.1 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 31 1.1 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 31 1.1 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 31 1.1 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 31 1.1 At1g04800.1 68414.m00476 glycine-rich protein 31 1.1 At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family p... 28 1.5 At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family pr... 31 1.5 At5g61660.1 68418.m07736 glycine-rich protein 31 1.5 At5g59270.1 68418.m07427 lectin protein kinase family protein co... 31 1.5 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.5 At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) ... 31 1.5 At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) ... 31 1.5 At3g26400.1 68416.m03292 eukaryotic translation initiation facto... 31 1.5 At1g45688.1 68414.m05202 expressed protein 31 1.5 At1g35617.1 68414.m04424 hypothetical protein 31 1.5 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 31 1.5 At1g23720.1 68414.m02994 proline-rich extensin-like family prote... 31 1.5 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 30 2.0 At5g10550.1 68418.m01221 DNA-binding bromodomain-containing prot... 30 2.0 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 30 2.0 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 30 2.0 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 30 2.0 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 30 2.0 At3g24540.1 68416.m03082 protein kinase family protein contains ... 30 2.0 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 30 2.0 At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein ... 30 2.0 At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ b... 30 2.0 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 30 2.0 At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ... 26 2.5 At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) 30 2.6 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 30 2.6 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 30 2.6 At2g11005.1 68415.m01177 glycine-rich protein 30 2.6 At2g05530.1 68415.m00585 glycine-rich protein 30 2.6 At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative si... 30 2.6 At1g11850.1 68414.m01363 expressed protein 30 2.6 At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing ... 29 3.5 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 29 3.5 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 29 3.5 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 29 3.5 At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi... 29 3.5 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 29 3.5 At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99... 29 3.5 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 29 3.5 At1g70140.1 68414.m08071 formin homology 2 domain-containing pro... 29 3.5 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 29 3.5 At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family... 29 3.5 At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin fa... 29 3.5 At1g15840.1 68414.m01901 expressed protein 29 3.5 At1g04660.1 68414.m00463 glycine-rich protein 29 3.5 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 29 3.9 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 24 3.9 At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, ... 25 4.0 At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family... 25 4.0 At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid t... 29 4.6 At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid t... 29 4.6 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 29 4.6 At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 29 4.6 At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (... 29 4.6 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 29 4.6 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 29 4.6 At3g04640.1 68416.m00497 glycine-rich protein predicted proteins... 29 4.6 At3g02670.1 68416.m00258 proline-rich family protein contains pr... 29 4.6 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 29 4.6 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 29 4.6 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 4.6 At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family... 29 4.6 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 29 4.6 At4g03390.1 68417.m00461 leucine-rich repeat transmembrane prote... 28 5.1 At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) ide... 29 6.0 At5g19090.2 68418.m02270 heavy-metal-associated domain-containin... 29 6.0 At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibri... 29 6.0 At4g15460.1 68417.m02363 glycine-rich protein 29 6.0 At4g14750.1 68417.m02270 calmodulin-binding family protein conta... 29 6.0 At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-conta... 29 6.0 At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) s... 29 6.0 At3g08640.1 68416.m01003 alphavirus core protein family contains... 29 6.0 At3g08630.1 68416.m01002 expressed protein 29 6.0 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 29 6.0 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 29 6.0 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 29 6.0 At1g23540.1 68414.m02960 protein kinase family protein contains ... 29 6.0 At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family... 29 6.0 At1g12810.1 68414.m01488 proline-rich family protein contains pr... 29 6.0 At1g07135.1 68414.m00759 glycine-rich protein 29 6.0 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 28 7.6 At5g66960.1 68418.m08442 prolyl oligopeptidase family protein si... 28 8.0 At5g56140.1 68418.m07003 KH domain-containing protein 28 8.0 At5g41460.1 68418.m05035 fringe-related protein strong similarit... 28 8.0 At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; g... 28 8.0 At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) i... 28 8.0 At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) i... 28 8.0 At4g15150.1 68417.m02326 glycine-rich protein 28 8.0 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 28 8.0 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 28 8.0 At3g43583.1 68416.m04636 hypothetical protein 28 8.0 At3g28550.1 68416.m03565 proline-rich extensin-like family prote... 28 8.0 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 28 8.0 At3g01560.1 68416.m00086 proline-rich family protein contains pr... 28 8.0 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 28 8.0 At2g39750.1 68415.m04881 dehydration-responsive family protein s... 28 8.0 At2g39250.1 68415.m04820 AP2 domain-containing transcription fac... 28 8.0 At2g30505.1 68415.m03716 Expressed protein 28 8.0 At1g76930.2 68414.m08956 proline-rich extensin-like family prote... 28 8.0 At1g76930.1 68414.m08955 proline-rich extensin-like family prote... 28 8.0 At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi do... 28 8.0 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 28 8.0 At1g61750.1 68414.m06964 expressed protein contains Pfam profile... 28 8.0 At1g35830.1 68414.m04452 VQ motif-containing protein contains PF... 28 8.0 At1g34000.2 68414.m04216 light stress-responsive one-helix prote... 28 8.0 At1g34000.1 68414.m04215 light stress-responsive one-helix prote... 28 8.0 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 54.4 bits (125), Expect = 1e-07 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P PPPP P P PPP P PP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPP 436 Query: 425 PXXPP 439 P PP Sbjct: 437 PPSPP 441 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P PPP P P PPP PP P PP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPP 422 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/58 (37%), Positives = 24/58 (41%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P P PPP P P PPP PP P PP+ P + PP P Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP--PPYVYPPPPPP 431 Score = 44.8 bits (101), Expect = 9e-05 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P PPPP P PPP +P P Sbjct: 397 PPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPYMY 456 Query: 425 PXXP 436 P P Sbjct: 457 PSPP 460 Score = 44.0 bits (99), Expect = 2e-04 Identities = 24/71 (33%), Positives = 25/71 (35%), Gaps = 6/71 (8%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP---PPXPXPAXXPPPXAPX- 412 P P PP PPPP P PP PP P P PPP +P Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPY 442 Query: 413 --PXPPPXXPP 439 P PPP P Sbjct: 443 VYPPPPPSPQP 453 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP PPP PP S P P PPP Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPP 428 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/52 (30%), Positives = 17/52 (32%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPP 560 PP PPPP PPP SPP P P + PP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +3 Query: 408 PXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 P PPPP PPP PP P +P + PPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP PPP PP S P P P P Sbjct: 388 PPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 48.0 bits (109), Expect = 9e-06 Identities = 27/96 (28%), Positives = 28/96 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPPP P PPPP P P PP P P Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSP 521 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PP+ P PP P Sbjct: 522 PPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 47.6 bits (108), Expect = 1e-05 Identities = 29/94 (30%), Positives = 31/94 (32%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PPPP P + PPP P P PP +P P PPP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYS------------PPPPPPPPPPPPVYSPPPPPPPP 473 Query: 431 XPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PP P PP P Sbjct: 474 PPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPP 507 Score = 45.2 bits (102), Expect = 6e-05 Identities = 29/96 (30%), Positives = 29/96 (30%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPPP PPPP P P PPP P P PP Sbjct: 403 PPPSLPSPPPPAPI-FSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPP 461 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PP P PP P Sbjct: 462 PVYSPPP----PPPPPPPPPPVYSPPPPSPPPPPPP 493 Score = 41.5 bits (93), Expect = 8e-04 Identities = 28/117 (23%), Positives = 32/117 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPPP P PPP P P P P P P Sbjct: 538 PPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXPLLXXIFXKGPP 595 PP P + P P PP P + P ++ PP Sbjct: 598 VSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPP--PPVYYSSPP 652 Score = 39.1 bits (87), Expect = 0.004 Identities = 28/100 (28%), Positives = 28/100 (28%), Gaps = 4/100 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXP----XPAXXPPPXAPX 412 P P PP PPP P PPPP P P PPP P Sbjct: 499 PPPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPY 558 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P PP P PP P Sbjct: 559 YYSSP-PPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTP 597 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/52 (32%), Positives = 18/52 (34%) Frame = +3 Query: 408 PXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 P PPPP PPP PP S S P P + PPP Sbjct: 451 PPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/67 (29%), Positives = 21/67 (31%), Gaps = 3/67 (4%) Frame = +2 Query: 245 PXPXP---PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXP 415 P P P P PPPP P PPPP + PPP Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVY-YS 659 Query: 416 XPPPXXP 436 PPP P Sbjct: 660 SPPPPPP 666 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/110 (21%), Positives = 33/110 (30%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXPPXX 445 PPPP + PP P + PPP AP PP P Sbjct: 652 PPPPVYYSSPPPPPPVHYSSPPPPEVHYHSPPPSPVHYSSPPPPPSAPCEESPPPAPVVH 711 Query: 446 XXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXPLLXXIFXKGPP 595 P + + P + + PP P G P++ + PP Sbjct: 712 HSP-----PPPMVHHSPPPPVIHQSPPPPSPEYEGPLPPVIGVSYASPPP 756 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/55 (30%), Positives = 19/55 (34%), Gaps = 2/55 (3%) Frame = +3 Query: 405 PPXXP--PPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP P PP PPP SPP + S P P + PPP Sbjct: 601 PPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/53 (28%), Positives = 18/53 (33%) Frame = +3 Query: 408 PXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF 566 P PPPP PPP + PP S P P + PP + Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVY 518 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPP P PPPP P PP P Sbjct: 593 PPPTPVSSPPPT--PVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSS 650 Query: 425 PXXPP 439 P PP Sbjct: 651 PPPPP 655 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 P PPPP PPP PP + P P PPP Sbjct: 462 PVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPP 514 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 3/67 (4%) Frame = +2 Query: 245 PXPXPPX---PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXP 415 P P PP PPPP PPP P PPP P Sbjct: 609 PPPPPPCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPPVYYSSPPPPPPVH 668 Query: 416 XPPPXXP 436 P P Sbjct: 669 YSSPPPP 675 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 47.2 bits (107), Expect = 2e-05 Identities = 26/85 (30%), Positives = 27/85 (31%), Gaps = 4/85 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXX----PXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPX 412 P P PP PPPP P + PPPP P P P A Sbjct: 597 PRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKC 656 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPP 487 PPP PP G P PP Sbjct: 657 APPPPPPPPTSHSGSIRVGPPSTPP 681 Score = 44.8 bits (101), Expect = 9e-05 Identities = 31/97 (31%), Positives = 32/97 (32%), Gaps = 3/97 (3%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXP---XPAXXPPPXAPXPXP 421 P PP PPPP PPPP P PA PPP + P P Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVP 739 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP PP G G PP G PP P Sbjct: 740 PP--PP-----GLGRGTSSGPPPLGAKGSNAPPPPPP 769 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/77 (28%), Positives = 22/77 (28%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 P PPPP P PPPP PPP A P P P P Sbjct: 543 PSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPP 602 Query: 437 PXXXXXGXXXGXPGLPP 487 P P PP Sbjct: 603 PPPPPSSRSIPSPSAPP 619 Score = 39.5 bits (88), Expect = 0.003 Identities = 30/108 (27%), Positives = 34/108 (31%), Gaps = 7/108 (6%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP----PPXPXPAXXPPPXAPXPX 418 P PP PPPP P PP PP P P AP P Sbjct: 640 PPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPP 699 Query: 419 PPPXXPPXXXXXGXXXGXPGLPPNR---GIPXXLXRXPPXP*IXGGGK 553 PP PP G P P ++ P L + P P G G+ Sbjct: 700 APPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGR 747 Score = 39.1 bits (87), Expect = 0.004 Identities = 24/69 (34%), Positives = 25/69 (36%), Gaps = 11/69 (15%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA---PXPXPPPXXPPXXXXXGXXXG--------XPGLPPNRGIPX 505 PPPP P P PPP + P P PP PP G P PP IP Sbjct: 594 PPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPA 653 Query: 506 XLXRXPPXP 532 PP P Sbjct: 654 AKCAPPPPP 662 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/102 (26%), Positives = 29/102 (28%), Gaps = 8/102 (7%) Frame = +2 Query: 245 PXPXPPXP----PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP----AXXPPP 400 P P PP P PPP P PPPP P P + Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKR 635 Query: 401 XAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 A P PPP PP P PP + PP Sbjct: 636 QAQPPPPPPPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVGPP 677 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/56 (32%), Positives = 20/56 (35%), Gaps = 3/56 (5%) Frame = +3 Query: 405 PPXXPPPPXPPP---XXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP PPP + A PP+ L P P PPP Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPP 731 Score = 31.5 bits (68), Expect = 0.86 Identities = 24/96 (25%), Positives = 24/96 (25%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPPP P P PP P P PP Sbjct: 522 PSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPP--PPPPPP 579 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PP P R P P Sbjct: 580 PPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSP 615 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P PPP PP P PP Sbjct: 484 PPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPP 526 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P PPP PP P PP Sbjct: 505 PPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPP 547 Score = 30.7 bits (66), Expect = 1.5 Identities = 23/91 (25%), Positives = 25/91 (27%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PPPP PPPP P +P PPP Sbjct: 482 PPPPPPPPP------------PLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPP 529 Query: 431 XPPXXXXXGXXXGXPGLPPNRGIPXXLXRXP 523 PP PP +P R P Sbjct: 530 PPPPLFTSTTSFSPSQPPPPPPLPSFSNRDP 560 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/58 (41%), Positives = 25/58 (43%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PPP +P P PPP PP P LPP P PP P Sbjct: 62 PPPPPPPPC--PPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPP--PAPPKPQPSPPTP 115 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/57 (38%), Positives = 23/57 (40%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PA PPP P P PPP PP P PP +P PP P Sbjct: 52 PEPEPEPADCPPPPPPPPCPPPPSPPPCP---PPPSPPPSPPPPQLPPPPQLPPPAP 105 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/64 (34%), Positives = 22/64 (34%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P PPP P P PPP P P P Sbjct: 64 PPPPPPCPPPPSPPP------------CPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPS 111 Query: 425 PXXP 436 P P Sbjct: 112 PPTP 115 Score = 35.1 bits (77), Expect = 0.069 Identities = 21/76 (27%), Positives = 22/76 (28%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP P P P PPPP P P+ PP P PP P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQ---LPPPPQLPP 102 Query: 437 PXXXXXGXXXGXPGLP 484 P P LP Sbjct: 103 PAPPKPQPSPPTPDLP 118 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/53 (28%), Positives = 17/53 (32%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPP PPP + SPP + P P P P Sbjct: 63 PPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTP 115 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 45.2 bits (102), Expect = 6e-05 Identities = 28/101 (27%), Positives = 29/101 (28%), Gaps = 5/101 (4%) Frame = +2 Query: 245 PXPXPPXP-----PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP 409 P P PP P PPP P PPPP A PPP P Sbjct: 510 PPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Query: 410 XPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP G P PP + PP P Sbjct: 570 MQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/96 (27%), Positives = 26/96 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PP PPPP P PPP P P Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAA 533 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP G P PP G PP P Sbjct: 534 VAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 42.3 bits (95), Expect = 5e-04 Identities = 29/101 (28%), Positives = 31/101 (30%), Gaps = 5/101 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP----X 412 P P PP PPPP PPPP P P PP P Sbjct: 416 PPPPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPP--PPPAVMPLKHFA 473 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPPN-RGIPXXLXRXPPXP 532 P PPP PP P PP + + PP P Sbjct: 474 PPPPPPLPPAVMPLKHFAPPPPTPPAFKPLKGSAPPPPPPP 514 Score = 41.9 bits (94), Expect = 6e-04 Identities = 30/99 (30%), Positives = 31/99 (31%), Gaps = 5/99 (5%) Frame = +2 Query: 251 PXPPXPPP-----PXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXP 415 P PP PPP P P PPPP P P P A Sbjct: 549 PPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPP-----PMPLANGA 603 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP G G P PP G+ PP P Sbjct: 604 TPPPPPPPMAMANGAA-GPPPPPPRMGMANGAAGPPPPP 641 Score = 36.7 bits (81), Expect = 0.023 Identities = 26/92 (28%), Positives = 26/92 (28%), Gaps = 8/92 (8%) Frame = +2 Query: 245 PXPXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPX 412 P P PP PPPP P PPPP P PP P Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Query: 413 PXP----PPXXPPXXXXXGXXXGXPGLPPNRG 496 P PP G G G PP G Sbjct: 611 PMAMANGAAGPPPPPPRMGMANGAAGPPPPPG 642 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/58 (29%), Positives = 17/58 (29%), Gaps = 5/58 (8%) Frame = +3 Query: 405 PPXXPPPPXP-----PPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPP 563 PP PPPP P PP R PP P P PPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 44.0 bits (99), Expect = 2e-04 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPPP P P+ PPP +P P P P P PG PP+ Sbjct: 164 PPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPS 207 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/78 (28%), Positives = 24/78 (30%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PPPP P P P P P PP +P P P P P Sbjct: 161 PPLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPG---PPPSPSPTPGPDSP 217 Query: 437 PXXXXXGXXXGXPGLPPN 490 PG PP+ Sbjct: 218 LPSPGPDSPLPLPGPPPS 235 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/65 (29%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXP-PPPXPXPAXXPPPXAPXPXP 421 P P PP P P P + P P P P P+ P P +P P P Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSP 221 Query: 422 PPXXP 436 P P Sbjct: 222 GPDSP 226 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +2 Query: 380 PAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PPP P P PPP P PG P+ +P L PP P Sbjct: 162 PLPPPPPPYPSPLPPPPSPSPTPGPDSPLPSPG--PDSPLP--LPGPPPSP 208 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/66 (28%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = +2 Query: 245 PXPXP-PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP-PXPXPAXXPPPXAPXPX 418 P P P P P P P + P P P P P+ P P +P P Sbjct: 208 PSPTPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPGPPPSPSPTPGPDSPLPS 267 Query: 419 PPPXXP 436 P P P Sbjct: 268 PGPDSP 273 Score = 30.7 bits (66), Expect = 1.5 Identities = 25/96 (26%), Positives = 27/96 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P PPP P P P P PP Sbjct: 200 PLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPG-------PPPSSSPTPGPDSPLPSPGPP 252 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P G P P+ +P PP P Sbjct: 253 PSPSP---TPGPDSPLPSPGPDSPLPSP-GPDPPLP 284 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 44.0 bits (99), Expect = 2e-04 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP PPPP P P PPP P P Sbjct: 53 PPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPPKPPQKNLP 112 Query: 425 PXXPP 439 PP Sbjct: 113 RRHPP 117 Score = 41.5 bits (93), Expect = 8e-04 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = +2 Query: 359 PP--PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PP P P P PPP P P PPP PP G P PP Sbjct: 35 PPLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 40.3 bits (90), Expect = 0.002 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXP---XPAXXPPPXAPXP 415 P PP PPPP P A PPPP P PPP P P Sbjct: 39 PQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPP 98 Query: 416 -XPPPXXPP 439 PP PP Sbjct: 99 RSQPPPKPP 107 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/76 (30%), Positives = 27/76 (35%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF*XKFXX 584 PP PPPP PPP PP + P P+ +PPP K Sbjct: 52 PPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQPPP---KPPQ 108 Query: 585 RGXPGXXPPXGGXPEK 632 + P PP PEK Sbjct: 109 KNLPRRHPPPPRSPEK 124 Score = 28.3 bits (60), Expect = 8.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP P P PPP P P PP R P Sbjct: 55 PPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQPPPRSQP 102 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 43.2 bits (97), Expect = 3e-04 Identities = 23/65 (35%), Positives = 24/65 (36%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PP P P PPPP P PPP +P P PP Sbjct: 1069 PPPLPPLPPSP---PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPP---PPPLSPPPSPP 1122 Query: 425 PXXPP 439 P PP Sbjct: 1123 PPPPP 1127 Score = 35.1 bits (77), Expect = 0.069 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P PPP P P PP P PP + PP P Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPP 1126 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/55 (32%), Positives = 22/55 (40%), Gaps = 4/55 (7%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA----PXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXL 511 P PP P + PPP A P P PP PP P PP++ + L Sbjct: 1082 PSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQSLTTQL 1136 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/57 (33%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPP-PXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P PP P +P P PP P P LPP P PP Sbjct: 1062 PPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPP 1118 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP-XPXPPPXXPP 439 P P P PPP P P PPP PP Sbjct: 1058 PEDSPPLPQESPPPLPPLPPSPPPPSPP 1085 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/57 (31%), Positives = 18/57 (31%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P PP P PPP PP PP P PP P Sbjct: 1073 PPLPPSPPPPSPPLPPSSLPPP--PPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 42.3 bits (95), Expect = 5e-04 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 245 PXPXP-PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P P P P PP P P A P PP P PA P P P P P Sbjct: 31 PKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKP 90 Query: 422 PPXXP 436 P P Sbjct: 91 APTPP 95 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/59 (32%), Positives = 19/59 (32%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 P PP P P A P PP P PA P P P P P P P Sbjct: 26 PKPPKPKPAPAPTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPP 84 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P PP P P PA PP P P P Sbjct: 24 PAPKPPKPKPAPA-PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPT 82 Query: 425 PXXP 436 P P Sbjct: 83 PPKP 86 Score = 37.9 bits (84), Expect = 0.010 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P PP P P PA PP P P P Sbjct: 35 PAPTPPKPKPTPA-PTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPT 93 Query: 425 PXXP 436 P P Sbjct: 94 PPNP 97 Score = 37.5 bits (83), Expect = 0.013 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P PP P P PA PP P P P Sbjct: 46 PAPTPPKPKPKPA-PTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPT 104 Query: 425 PXXP 436 P P Sbjct: 105 PPKP 108 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P PP P P PA PP P P P Sbjct: 57 PAPTPPKPKPAPA-PTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAPA 115 Query: 425 PXXPP 439 P P Sbjct: 116 PTPAP 120 Score = 36.3 bits (80), Expect = 0.030 Identities = 23/72 (31%), Positives = 23/72 (31%), Gaps = 1/72 (1%) Frame = +2 Query: 245 PXPXP-PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P P P P PP P P A P PP P PA P AP P P Sbjct: 64 PKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAPAP---APTPAP 120 Query: 422 PPXXPPXXXXXG 457 P P G Sbjct: 121 KPKPAPKPAPGG 132 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 5/70 (7%) Frame = +2 Query: 245 PXPXP-PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX----AP 409 P P P P PP P P A P PP P P P P AP Sbjct: 53 PKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Query: 410 XPXPPPXXPP 439 P P P P Sbjct: 113 APAPTPAPKP 122 Score = 33.5 bits (73), Expect = 0.21 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P P P P P P P P P P P P + P P Sbjct: 37 PTPPKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTP 94 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 39.5 bits (88), Expect(2) = 5e-04 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXG 469 PPPP P P PPP PPP PP G G Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPPPPGALGRGAGGG 715 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P PPP P Sbjct: 672 PPLPGGGPPPPPPPPGGGPPPPPGGGP 698 Score = 21.8 bits (44), Expect(2) = 5e-04 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P PP PPPP Sbjct: 675 PGGGPPPPPPP 685 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 41.5 bits (93), Expect = 8e-04 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG AG GG G G G GG G Sbjct: 162 GGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGG 221 Query: 258 GXGXG 244 G G Sbjct: 222 AYGGG 226 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG G G GA GGG G G GGGG G G GG G Sbjct: 153 GGAGASGYGGGAYGGG--GGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYG 210 Query: 258 GXGXG 244 G G G Sbjct: 211 GGGGG 215 Score = 38.3 bits (85), Expect = 0.007 Identities = 25/74 (33%), Positives = 26/74 (35%), Gaps = 9/74 (12%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG---------GXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXG 286 GG GGG G GA GG G +G G GGGG G Sbjct: 58 GGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAASSGGYASGAGEGGGGGYGGAAG 117 Query: 285 XXXGGGGXGGXGXG 244 GGGG G G G Sbjct: 118 GHAGGGGGGSGGGG 131 Score = 37.9 bits (84), Expect = 0.010 Identities = 24/70 (34%), Positives = 24/70 (34%), Gaps = 5/70 (7%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXG-----GGGXXXXXXXXXXXAXXXXXXXXXXXGXXXG 274 GG GG G GA GGG G G G GGG G G Sbjct: 211 GGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYGGEHG 270 Query: 273 GGGXGGXGXG 244 GG GG G G Sbjct: 271 GGSGGGHGGG 280 Score = 37.5 bits (83), Expect = 0.013 Identities = 21/64 (32%), Positives = 22/64 (34%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G+ GGG G G GGG G GGGG G Sbjct: 207 GGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGGSYG 266 Query: 255 XGXG 244 G Sbjct: 267 GEHG 270 Score = 35.9 bits (79), Expect = 0.040 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 G GGG G GGG G G GGG G GG G Sbjct: 148 GAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAG 207 Query: 258 GXGXG 244 G G G Sbjct: 208 GYGGG 212 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/64 (32%), Positives = 21/64 (32%), Gaps = 1/64 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-GXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GG G G GG G G GGGG GGGG Sbjct: 200 GGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGE 259 Query: 261 GGXG 250 GG G Sbjct: 260 GGGG 263 Score = 33.5 bits (73), Expect = 0.21 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXG-GGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GGG G G GG G G G GGG A G G G Sbjct: 103 GAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAGASGYGG 162 Query: 261 GGXGXG 244 G G G Sbjct: 163 GAYGGG 168 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GGG G G GGG Sbjct: 257 GGEGGGGSYGGEHGGGSGGGHGGGGG 282 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G+ GGG G G GGGG Sbjct: 262 GGSYGGEHGGGS-GGGHGGGGGHGGGG 287 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/63 (30%), Positives = 20/63 (31%), Gaps = 2/63 (3%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAG--XGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGX 253 GGG G G GG +G G GGG G GGGG G Sbjct: 36 GGGHGGGGGSGGVSSGGYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGGAA 95 Query: 252 GXG 244 G Sbjct: 96 SSG 98 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 G G G G GA G G GGGG G GGGG Sbjct: 144 GYGNGAGEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSH 203 Query: 258 GXGXG 244 G G Sbjct: 204 GGAGG 208 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GG G GGGG Sbjct: 256 GGGEGGGGSYGGEHGGGSGGGHGGGGG 282 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 41.5 bits (93), Expect = 8e-04 Identities = 20/64 (31%), Positives = 20/64 (31%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP PPPP P P PP P P PP Sbjct: 115 PPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPP 174 Query: 425 PXXP 436 P P Sbjct: 175 PPKP 178 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 3/66 (4%) Frame = +2 Query: 251 PXPPX---PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P PP PPPP P PPPP P P PPP P P Sbjct: 82 PKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPP-PTPYTPPPPTPYTPPP 140 Query: 422 PPXXPP 439 P PP Sbjct: 141 PTVKPP 146 Score = 37.9 bits (84), Expect = 0.010 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 2/67 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX--PXPAXXPPPXAPXPX 418 P P PPPP P PPPP P P P AP P Sbjct: 107 PPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPP 166 Query: 419 PPPXXPP 439 PPP P Sbjct: 167 PPPTPYP 173 Score = 36.3 bits (80), Expect = 0.030 Identities = 24/84 (28%), Positives = 24/84 (28%), Gaps = 3/84 (3%) Frame = +2 Query: 245 PXPXP---PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXP 415 P P P P PPP P PPPP P PPP P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYT---PPPPTVKP 145 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPP 487 PPP P P PP Sbjct: 146 PPPPVVTPPPPTPTPEAPCPPPPP 169 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPX-PAXXPPPXAPXPXP 421 P PP PP P P PP P P P PPP P P Sbjct: 117 PTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Query: 422 PPXXPP 439 P P Sbjct: 177 KPETCP 182 Score = 33.1 bits (72), Expect = 0.28 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 2/98 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX-PXPAXXPPPXAPXPXP 421 P P P P P PPPP P P PP P P Sbjct: 38 PVKPPKHPAKPPKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Query: 422 PPXXPPXXXXXGXXXGXPGLPPN-RGIPXXLXRXPPXP 532 PP PP P PP + P PP P Sbjct: 98 PP--PPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPP 133 Score = 32.7 bits (71), Expect = 0.37 Identities = 26/99 (26%), Positives = 28/99 (28%), Gaps = 5/99 (5%) Frame = +2 Query: 251 PXPPX-PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPP 427 P PP PPP P PPPP P PP P P P Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKPPP-PPYVKPPPPPTV 119 Query: 428 XXPPXXXXXGXXXGXPGLPPNRGI----PXXLXRXPPXP 532 PP P PP + P + PP P Sbjct: 120 KPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P P P A P PP PP Sbjct: 31 PPKPSPHPVKPPKHPAKPPKPPTVKPP 57 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 41.5 bits (93), Expect = 8e-04 Identities = 23/80 (28%), Positives = 30/80 (37%), Gaps = 1/80 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXR-XPPXP* 535 PPPP P P PP +P P PP PP P + + P + PP P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPS 470 Query: 536 IXGGGKTXPLLXXIFXKGPP 595 G P++ + PP Sbjct: 471 PEFEGPLPPVIGVSYASPPP 490 Score = 34.3 bits (75), Expect = 0.12 Identities = 21/82 (25%), Positives = 24/82 (29%), Gaps = 3/82 (3%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPP---XAPXPXP 421 P PP P PP P + PPP + PPP +P P Sbjct: 411 PPPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPPVHHSSPPPPS 470 Query: 422 PPXXPPXXXXXGXXXGXPGLPP 487 P P G P PP Sbjct: 471 PEFEGPLPPVIGVSYASPPPPP 492 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 41.5 bits (93), Expect = 8e-04 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P PPP P P PPP PP Sbjct: 67 PPPTSPPPPSPPPPSPPPPSPPPPSPP 93 Score = 39.9 bits (89), Expect = 0.002 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P PPP P P PPP Sbjct: 72 PPPPSPPPPSPPPPSPPPPSPPP 94 Score = 39.5 bits (88), Expect = 0.003 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P P PPP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPP 88 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P P P PP PP Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPPSPPPP 90 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 41.5 bits (93), Expect = 8e-04 Identities = 25/68 (36%), Positives = 26/68 (38%), Gaps = 3/68 (4%) Frame = -3 Query: 438 GGXXGGGXGXGA---XGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGG 268 GG GGG G GA GGG +G G GGGG G GGG Sbjct: 22 GGGRGGGGGGGAKGGCGGGGKSGGGGGGGGYMVAPGSNRSSYISRDNFESDPKGGSGGGG 81 Query: 267 GXGGXGXG 244 GG G G Sbjct: 82 KGGGGGGG 89 Score = 36.7 bits (81), Expect = 0.023 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 5 GGSGSGGGGKGGGGGGSGGGRGGGGGG 31 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G G +G G GGGG Sbjct: 112 GGKNGGGCGGGGGGKGGKSGGGSGGGG 138 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = -3 Query: 423 GGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGXG 244 GG G G GGG G G GGG + G GGGG GG G Sbjct: 75 GGSGGGGKGGG--GGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGG 132 Score = 33.9 bits (74), Expect = 0.16 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAGXGXGGG 361 P GG GGG G G GGG G GGG Sbjct: 73 PKGGSGGGGKGGGGGGGISGGGAGGKSGCGGG 104 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G GG Sbjct: 103 GGKSGGGGGGGKNGGGCGGGGGGKGG 128 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGA-XGGGXXAGXGXGGGG 358 GG G G G G GGG +G G GGGG Sbjct: 2 GGKGGSGSGGGGKGGGGGGSGGGRGGGG 29 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G GGG A G GGGG Sbjct: 15 GGGGGGSGGGRGGGGGGGAKGGCGGGG 41 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G GG G GGG G GG G G Sbjct: 78 GGGGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Query: 258 G 256 G Sbjct: 138 G 138 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG +G G GG G GG G Sbjct: 75 GGSGGGGKG-GG-GGGGISGGGAGGKSGCGGGKSGGGGGGGKNGGGCGGGGGGKGGKSGG 132 Query: 258 GXGXG 244 G G G Sbjct: 133 GSGGG 137 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 35.1 bits (77), Expect(2) = 0.001 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P P +P P PPP PP Sbjct: 65 PPPSPPPPKKSSCPPSPLPPPPPPPPP 91 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPP P PPP + P PPP PP PP P + PP Sbjct: 49 PPPPPS----PPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPNYVFTYPP 99 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPP P P+ P P P P PPP P PPN Sbjct: 51 PPPSPPPPSCTPSP--PPPSPPPPKKSSCPPSPLPPPPPPPPPN 92 Score = 25.4 bits (53), Expect(2) = 0.001 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 62 PSPPPPSPPPP 72 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 40.7 bits (91), Expect = 0.001 Identities = 22/69 (31%), Positives = 22/69 (31%), Gaps = 4/69 (5%) Frame = +2 Query: 245 PXPXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPX 412 P P PP PPPP P PPPP P P PP P Sbjct: 23 PVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPH 82 Query: 413 PXPPPXXPP 439 PPP P Sbjct: 83 VLPPPPPTP 91 Score = 37.1 bits (82), Expect = 0.017 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPP P PPP P P PPP +P P P Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQ---PPPSPYPHPHPPPPSPYPHPH 75 Query: 425 PXXPP 439 PP Sbjct: 76 QPPPP 80 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP PP P PPP P P PP P + PP P Sbjct: 25 PPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHP-HQPPPPP 81 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P+ PPP + PPP P P PP P PP P Sbjct: 14 PSHQHPLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPYPHP-HPPPPSP 70 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/43 (32%), Positives = 15/43 (34%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN 490 PP P P PP P P P P P P PP+ Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPH 82 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 40.7 bits (91), Expect = 0.001 Identities = 30/98 (30%), Positives = 32/98 (32%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PPPP P PP P PA PP AP PP Sbjct: 137 PPAPPPPEQLPPPASSPQGGPKKPKKHHPGPATSPPAPSA-PATSPP--APPNAPPRNSS 193 Query: 437 PXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGG 550 G P P+RG+P PP P GGG Sbjct: 194 HALPPKSTAAGGPLTSPSRGVPSSGNSVPP-PANSGGG 230 Score = 36.3 bits (80), Expect = 0.030 Identities = 22/70 (31%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = +2 Query: 245 PXPXPPXP--PPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX---PXPAXXPPPXAP 409 P P PP PPP PPPP P P+ PPP AP Sbjct: 37 PPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAP 96 Query: 410 XPXPPPXXPP 439 P P PP Sbjct: 97 PPIPIVFPPP 106 Score = 36.3 bits (80), Expect = 0.030 Identities = 24/95 (25%), Positives = 26/95 (27%), Gaps = 1/95 (1%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP-PXAPXPXPPP 427 P PP PPP + PPPP PP P P PPP Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPPEQLPPP 149 Query: 428 XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PG + P PP P Sbjct: 150 ASSPQGGPKKPKKHHPGPATSPPAPSAPATSPPAP 184 Score = 33.1 bits (72), Expect = 0.28 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PP P PPP P P PPP P PP Sbjct: 47 PPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPP-IPIVFPP 105 Query: 425 PXXPP 439 P P Sbjct: 106 PIDSP 110 Score = 29.1 bits (62), Expect = 4.6 Identities = 23/94 (24%), Positives = 24/94 (25%), Gaps = 5/94 (5%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXPPXX 445 PPP P PPP P PPP P PPP P Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPP--PPPLDSSPPPPPDLTPPP 87 Query: 446 XXXGXXXGXPGL-----PPNRGIPXXLXRXPPXP 532 P + PP P PP P Sbjct: 88 SSPPPPDAPPPIPIVFPPPIDSPPPESTNSPPPP 121 Score = 28.3 bits (60), Expect = 8.0 Identities = 22/79 (27%), Positives = 23/79 (29%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 PPP PP P PP PP P LPP P PP P + Sbjct: 18 PPPDTSSDGSAAPP--PTDSAPPPSPPADS--SPPPALPSLPPAVFSPPPTVSSPPPPPL 73 Query: 539 XGGGKTXPLLXXIFXKGPP 595 P L PP Sbjct: 74 DSSPPPPPDLTPPPSSPPP 92 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 40.3 bits (90), Expect = 0.002 Identities = 24/65 (36%), Positives = 24/65 (36%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GG AG G GGG A G GGG G Sbjct: 64 GGGGGGGGGIGG-SGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGG 122 Query: 258 GXGXG 244 G G G Sbjct: 123 GVGAG 127 Score = 38.3 bits (85), Expect = 0.007 Identities = 23/66 (34%), Positives = 23/66 (34%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG-GXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GG G G GG AG G GGG G G GGGG Sbjct: 406 GGASGGVGGAGGAGGSVGAGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGR 465 Query: 261 GGXGXG 244 G G G Sbjct: 466 GSGGAG 471 Score = 37.5 bits (83), Expect = 0.013 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GA GGG G G GG G G G GG Sbjct: 137 GGGIGGGAG-GAIGGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGI 195 Query: 258 GXGXG 244 G G G Sbjct: 196 GSGGG 200 Score = 36.3 bits (80), Expect = 0.030 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G GGG G G G GG G GGG G Sbjct: 295 GGAVGGAVGGG--GGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGG 352 Query: 258 GXGXG 244 G G G Sbjct: 353 GVGGG 357 Score = 36.3 bits (80), Expect = 0.030 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GGG G GGG G Sbjct: 449 GGAVGGGGGGSVGGGG--RGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGG 506 Query: 258 GXGXG 244 G G G Sbjct: 507 GVGGG 511 Score = 35.9 bits (79), Expect = 0.040 Identities = 21/61 (34%), Positives = 21/61 (34%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 G G G GA GG G G GGGG G GG G GG G Sbjct: 50 GAGAGGGA-SGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGR 108 Query: 246 G 244 G Sbjct: 109 G 109 Score = 35.5 bits (78), Expect = 0.053 Identities = 23/70 (32%), Positives = 24/70 (34%), Gaps = 5/70 (7%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG-----GXXXXXXXXXXXAXXXXXXXXXXXGXXXG 274 GG GGG GA GGG G GGG G + G G Sbjct: 90 GGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIG 149 Query: 273 GGGXGGXGXG 244 GG GG G G Sbjct: 150 GGASGGVGGG 159 Score = 35.1 bits (77), Expect = 0.069 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-----GXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXG 274 GG GG G G GG G G G GGG A G G Sbjct: 54 GGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGG 113 Query: 273 GGGXGGXGXG 244 GG GG G G Sbjct: 114 GGAGGGVGGG 123 Score = 34.7 bits (76), Expect = 0.092 Identities = 21/63 (33%), Positives = 21/63 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GGG G GGGG Sbjct: 145 GGAIGGGASGGVGGGGKGRG-GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTV 203 Query: 258 GXG 250 G G Sbjct: 204 GAG 206 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG G G G G+ GGG G G GG G GGG G Sbjct: 186 GGSVGAGGGIGSGGGGTVGAGGRGSGG----ASGGGGTVGAGGRGSGGASGGVGVGGGAG 241 Query: 258 GXGXG 244 G G G Sbjct: 242 GSGGG 246 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/67 (31%), Positives = 22/67 (32%), Gaps = 2/67 (2%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG--GGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGG 265 GG GGG G GGG +G GG GG G G GG Sbjct: 367 GGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAGGSVGAGG 426 Query: 264 XGGXGXG 244 G G G Sbjct: 427 GVGGGVG 433 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG G G G G GG AG G GGG A G GGG G Sbjct: 522 GGVGGAGRGSGGASGGAGAGGGAGGGVGGGANVGVGVGA-----------GGSTGGGAAG 570 Query: 258 GXGXG 244 G G G Sbjct: 571 GGGVG 575 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/64 (31%), Positives = 22/64 (34%), Gaps = 1/64 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG-GXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GG G G G G +G G GGG G + G G GG Sbjct: 149 GGGASGGVGGGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSGGGGTVGAGGR 208 Query: 261 GGXG 250 G G Sbjct: 209 GSGG 212 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/73 (32%), Positives = 24/73 (32%), Gaps = 8/73 (10%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG------GXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXX 277 G GGG G G GG G G G GGGG G Sbjct: 458 GSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVGGGVRGAVG 517 Query: 276 G--GGGXGGXGXG 244 G GGG GG G G Sbjct: 518 GAVGGGVGGAGRG 530 Score = 32.7 bits (71), Expect = 0.37 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = -3 Query: 438 GGXXGGGXGXGAXG--GGXXAGXGXGGG-GXXXXXXXXXXXAXXXXXXXXXXXGXXXGGG 268 G GGG G G G GG G GGG G G GGG Sbjct: 246 GSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGGAVGGG 305 Query: 267 GXGGXGXG 244 G G G G Sbjct: 306 GGGSVGGG 313 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GG + G GGG G Sbjct: 299 GGAVGGGGGGSVGGGG--RGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGG 356 Query: 258 GXG 250 G G Sbjct: 357 GVG 359 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G G +G G G GG G GGGG G Sbjct: 517 GGAVGGGVGGAGRGSGGASG-GAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGGVG 575 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G G G G G GGG G G G GG G G GG G Sbjct: 232 GGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVG 291 Query: 255 XGXG 244 G Sbjct: 292 GAVG 295 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G G G G GG +G G GGG G GGG GG Sbjct: 226 GSGGASGGVGVGGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGG 285 Query: 255 XG 250 G Sbjct: 286 VG 287 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/68 (29%), Positives = 20/68 (29%), Gaps = 5/68 (7%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-----GXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXG 274 GG GGG G G GG G G GGGG G G Sbjct: 343 GGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGASGGASGGASG 402 Query: 273 GGGXGGXG 250 G G G Sbjct: 403 GASGGASG 410 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAX-GGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG G G G G GGG G G G GG G GG Sbjct: 333 GGSVGAGGGVGGGVGGGVGGGVGGGVGGAVGGAVGGAVGGGGGGSVGGGGRGSGGASGGA 392 Query: 261 GGXGXG 244 G G Sbjct: 393 SGGASG 398 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/65 (26%), Positives = 17/65 (26%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G G G G GG G GG G Sbjct: 241 GGSGGGSVGGGGRGSGGVGASGGAGGNVGAGGGLGGGVGGGVGGGVGGSVGGAVGGAVGG 300 Query: 258 GXGXG 244 G G Sbjct: 301 AVGGG 305 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 40.3 bits (90), Expect = 0.002 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 4/98 (4%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP----PXPXPAXXPPPXAPXPX 418 P PP PP P PPP P P P PPP P Sbjct: 494 PPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPP 553 Query: 419 PPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP PP PP P + PP P Sbjct: 554 PPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 38.3 bits (85), Expect = 0.007 Identities = 21/68 (30%), Positives = 21/68 (30%), Gaps = 3/68 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP---PPXPXPAXXPPPXAPXP 415 P P PPPP P PP PP P P PPP P Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP 632 Query: 416 XPPPXXPP 439 PP PP Sbjct: 633 PPPVHSPP 640 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/100 (27%), Positives = 28/100 (28%), Gaps = 4/100 (4%) Frame = +2 Query: 245 PXPXPPX--PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXP--PPPXPXPAXXPPPXAPX 412 P P PP PPPP P P PP P + PPP Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSP 595 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P PP P PP P PP P Sbjct: 596 PPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/94 (26%), Positives = 28/94 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP P PPPP P + PP +P P P Sbjct: 581 PPPVYSPPPPPVHSPPPPVHSPPPPV---HSPPPPVYSPPPPPPVHSPPPPVFSP-PPPV 636 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P PP + P PP Sbjct: 637 HSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPP 670 Score = 32.3 bits (70), Expect = 0.49 Identities = 25/89 (28%), Positives = 25/89 (28%), Gaps = 3/89 (3%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXP---XPAXXPPPXAPXP 415 P P PPPP P PPPP P PPP P Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFS-PPPPVHSPPPPVYSPPPPVYSP 653 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPP P P LPP P Sbjct: 654 PPPPVKSPPPP---PVYSPPLLPPKMSSP 679 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P + PP P PPP P Sbjct: 493 PPPPPVHSPPPPSPIHSPPPPPVYSP 518 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP---XPXPPPXXPP 439 PPPP P PPP +P P PP PP Sbjct: 493 PPPP---PVHSPPPPSPIHSPPPPPVYSPP 519 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 39.9 bits (89), Expect = 0.002 Identities = 24/96 (25%), Positives = 26/96 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP P P P PPPP P P+ P P P PP Sbjct: 79 PPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSV-PSPTPPVSPPP 137 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P P +P P P Sbjct: 138 PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDP 173 Score = 39.5 bits (88), Expect = 0.003 Identities = 22/81 (27%), Positives = 22/81 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P P PP P P P P P PPP P P P Sbjct: 104 PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 163 Query: 425 PXXPPXXXXXGXXXGXPGLPP 487 PP P PP Sbjct: 164 SPTPPVPTDPMPSPPPPVSPP 184 Score = 38.7 bits (86), Expect = 0.006 Identities = 25/96 (26%), Positives = 28/96 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPP PPPP P P+ PP P PP Sbjct: 145 PSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDV-TPTPP 203 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P +P P + PP P Sbjct: 204 TPSVPSPPDVTPTPPTPSVPS----PPDVTPTPPTP 235 Score = 37.9 bits (84), Expect = 0.010 Identities = 26/98 (26%), Positives = 27/98 (27%), Gaps = 2/98 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPP PP P P P P P P PP Sbjct: 75 PAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPT--PTPSVPSPTPP 132 Query: 425 PXXPPXXXXXGXXXGXPGL--PPNRGIPXXLXRXPPXP 532 PP P + PP P PP P Sbjct: 133 VSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVP 170 Score = 33.1 bits (72), Expect = 0.28 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPP-PXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P + PP P P P PP PP P + P P P P Sbjct: 74 PPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPP 132 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/66 (28%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXP-XP 421 P P P P PP P P PP P PP P P Sbjct: 186 PTPTPSVPSPPDVTPTPPTPSVPSPP-DVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGS 244 Query: 422 PPXXPP 439 PP PP Sbjct: 245 PPYVPP 250 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 33.5 bits (73), Expect(2) = 0.003 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +2 Query: 359 PPPPXPXP---AXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG 478 PPPP P P A PPP P P PP G PG Sbjct: 96 PPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPPG 138 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P+ PP A P P P PP Sbjct: 92 PPPSPPPPSPPPPSQACPPPPLPPSPP 118 Score = 25.4 bits (53), Expect(2) = 0.003 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 94 PSPPPPSPPPP 104 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 39.5 bits (88), Expect = 0.003 Identities = 24/96 (25%), Positives = 26/96 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P + P P P PPP P PP Sbjct: 643 PVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPP 702 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP PP P + PP P Sbjct: 703 VHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 37.5 bits (83), Expect = 0.013 Identities = 26/96 (27%), Positives = 27/96 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP P PPPP P + PPP P PP Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPP-PVHS--PPPPVHSPPPP 769 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P PP P PP P Sbjct: 770 PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 805 Score = 36.7 bits (81), Expect = 0.023 Identities = 24/96 (25%), Positives = 27/96 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP P PPPP P + PP +P P Sbjct: 728 PPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPP-PVHSPPPPVHSPPPPVH 786 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P P + PP P Sbjct: 787 SPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKP 822 Score = 33.5 bits (73), Expect = 0.21 Identities = 19/65 (29%), Positives = 21/65 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP P PPPP P + PP +P P P Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPV---HSPPPPVHSPPPPSPIYSPPPPVFSPPPKPV 823 Query: 425 PXXPP 439 PP Sbjct: 824 TPLPP 828 Score = 30.7 bits (66), Expect = 1.5 Identities = 27/101 (26%), Positives = 31/101 (30%), Gaps = 7/101 (6%) Frame = +2 Query: 251 PXPPX--PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP---PPXPXPAXXPPPXAPXP 415 P PP PPPP P PP PP P + PP +P P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP-P 714 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPP--NRGIPXXLXRXPPXP 532 P PP P PP + P + PP P Sbjct: 715 PPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPP 755 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 3/67 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX---PXPAXXPPPXAPXP 415 P P P PPP PP P P P PPP P Sbjct: 766 PPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Query: 416 XPPPXXP 436 PP P Sbjct: 826 LPPATSP 832 Score = 29.9 bits (64), Expect = 2.6 Identities = 27/108 (25%), Positives = 28/108 (25%), Gaps = 12/108 (11%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP----PPXPX----PAXXPPP 400 P P PPPP P PP PP P PPP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP 722 Query: 401 XAPXPXPPPXXPPXXXXXGXXXG----XPGLPPNRGIPXXLXRXPPXP 532 P PP PP P PP P + PP P Sbjct: 723 PVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSPPPPVHSPPPPP 770 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/57 (28%), Positives = 17/57 (29%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P + PPP P PP PP PP P PP P Sbjct: 639 PQSPPVHSPPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 39.5 bits (88), Expect = 0.003 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 GGG G G+ GGG G G G A G GGGG GG G Sbjct: 146 GGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASGPDVYMHVEGGGGGGGGGGGGGGG 205 Query: 246 G 244 G Sbjct: 206 G 206 Score = 34.7 bits (76), Expect = 0.092 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G G G +G G GGG Sbjct: 196 GGGGGGGGGGGVDGSGSGSGSGSGGG 221 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG--GXXAGXGXGGGG 358 GG GGG G G GG G +G G G GG Sbjct: 192 GGGGGGGGGGGGGGGVDGSGSGSGSGSGG 220 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXG-GGGX 262 GG GGG G G G G G G G G G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGEGSGG 155 Query: 261 GGXGXG 244 GG G G Sbjct: 156 GGGGDG 161 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSG 215 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G G +G G G G Sbjct: 198 GGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/61 (29%), Positives = 18/61 (29%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 GGG G G GGG G G GG G G GG G Sbjct: 95 GGGGGGGGGGGG---GGGSGGSNGSFFNGSGSGTGYGSGDGRVSSSGEYSASAGGGGSGE 151 Query: 246 G 244 G Sbjct: 152 G 152 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 33.1 bits (72), Expect(2) = 0.003 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P P PPP PP Sbjct: 47 PPPPPPPPLYFSYFSLPPPPPPPHLPP 73 Score = 25.4 bits (53), Expect(2) = 0.003 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 42 PHPPPPPPPPP 52 Score = 25.4 bits (53), Expect(2) = 1.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 408 PXXPPPPXPPP 440 P PPPP PPP Sbjct: 42 PHPPPPPPPPP 52 Score = 24.2 bits (50), Expect(2) = 1.1 Identities = 9/24 (37%), Positives = 10/24 (41%) Frame = +3 Query: 417 PPPPXPPPXXXXXXRXXAXXXSPP 488 PPPP PPP + PP Sbjct: 44 PPPPPPPPPPPLYFSYFSLPPPPP 67 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 39.1 bits (87), Expect = 0.004 Identities = 25/94 (26%), Positives = 27/94 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP A PP P + PPP P P P Sbjct: 687 PRPPPPPPPPPMQHSTVTKVPPPPPPAPPA--------PPTPIVHTSSPPPPPPPPPPPA 738 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P P P P +P PP Sbjct: 739 PPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP 772 Score = 31.9 bits (69), Expect = 0.65 Identities = 26/99 (26%), Positives = 28/99 (28%), Gaps = 2/99 (2%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PPPP P A PP P P P A P P P Sbjct: 727 PPPPPPPPPPPAPPTPQSNGISAMKSS--------PPAPPAPPRLPTHSASPPPPTAPPP 778 Query: 437 PXXXXXGXXXGXPGLPPNRG--IPXXLXRXPPXP*IXGG 547 P P PP G + PP P + G Sbjct: 779 PPLGQTRAPSAPPPPPPKLGTKLSPSGPNVPPTPALPTG 817 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/71 (26%), Positives = 21/71 (29%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF*XKFXX 584 PP PPPP P P A SPP + +P PPP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPPLGQTRAP 787 Query: 585 RGXPGXXPPXG 617 P P G Sbjct: 788 SAPPPPPPKLG 798 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 39.1 bits (87), Expect = 0.004 Identities = 22/67 (32%), Positives = 24/67 (35%), Gaps = 2/67 (2%) Frame = +2 Query: 245 PXPXPPX--PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P P PP PPPP P PPPP P + PP +P P Sbjct: 559 PPPPPPVHSPPPPVFSPPPPVYSPPPPV---HSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Query: 419 PPPXXPP 439 PP PP Sbjct: 616 PPVYSPP 622 Score = 37.1 bits (82), Expect = 0.017 Identities = 25/96 (26%), Positives = 28/96 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPPP P PPPP P + PP +P P Sbjct: 529 PVYSPPPPPPPVHSPPPPVHSPPPPPVYSP--------PPPPPPVHSPPPPVFSPPPPVY 580 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P P + PP P Sbjct: 581 SPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPPP 616 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGG 99 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 75 GGGGGGGGGGGGGGGGGGWGWGGGGGG 101 Score = 37.9 bits (84), Expect = 0.010 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 77 GGGGGGGGGGGGGGGGWGWGGGGGGGG 103 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G G GG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGG 97 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G GGGG Sbjct: 76 GGGGGGGGGGGGGGGGGWGWGGGGGGG 102 Score = 35.1 bits (77), Expect = 0.069 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG G G GGGG Sbjct: 70 GGGGGGGGGGGGGGGGGGGGGGG 92 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGG 92 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G GG G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWG 94 Score = 31.9 bits (69), Expect = 0.65 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 3/30 (10%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAG---XGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 84 GGGGGGGGGWGWGGGGGGGGWYKWGCGGGG 113 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 63 GSYRWGWGGGGGGGGGGGGGGGGGGGG 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G GGG G G GGGG Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGG 86 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 38.7 bits (86), Expect = 0.006 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GG G G GGG G GGGG G Sbjct: 98 GGGRGGGRGSGGGYGGGGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGGGGGG 157 Query: 258 GXGXG 244 G G Sbjct: 158 YGGGG 162 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G GGGG Sbjct: 155 GGGYGGGGGYGGGGGGYGGGGRGGGGG 181 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G GGGG Sbjct: 149 GGYGGGGGGYGGGGGYGGGGGGYGGGG 175 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/64 (32%), Positives = 21/64 (32%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G GG G G GG G GGGG GG Sbjct: 95 GGFGGGRGGGRGSGGGYGG-GGGGYGGRGGGGRGGSDCYKCGEPGHMARDCSEGGGGYGG 153 Query: 255 XGXG 244 G G Sbjct: 154 GGGG 157 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/22 (59%), Positives = 13/22 (59%) Frame = -3 Query: 423 GGXGXGAXGGGXXAGXGXGGGG 358 GG G G GGG G G GGGG Sbjct: 147 GGGGYGGGGGGYGGGGGYGGGG 168 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGG Sbjct: 148 GGGYGGGGGGYGGGGGYGGGGGGYGGG 174 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G G GGG G G GGG Sbjct: 153 GGGGGYGGGGGYGGGGGGYGGGGRGGG 179 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG G G G G GGG G G GG Sbjct: 159 GGGGGYGGGGGGYGGGGRGGGGGGG 183 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G G G G GGGG Sbjct: 157 GYGGGGGYGGGGGGYGGGGRGGGGGGG 183 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 38.7 bits (86), Expect = 0.006 Identities = 23/66 (34%), Positives = 24/66 (36%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXA-GXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG GGG G G+ GGG G G GGG G GGGG Sbjct: 105 GGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYSGGGGG 164 Query: 261 GGXGXG 244 G G G Sbjct: 165 GRYGSG 170 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G G GGGG Sbjct: 100 GGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGGGDNSCFKCGEPGHMARECSQGGGGYS 159 Query: 258 GXGXG 244 G G G Sbjct: 160 GGGGG 164 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GG +G G GGGG Sbjct: 155 GGGYSGGGGGGRYGSGGGGGGGG 177 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 423 GGXGXGAXGGGXXAGXGXGGGG 358 GG G GGG G G GGGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGG 175 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G G G G G GGGG Sbjct: 155 GGGYSGGGGGGRYGSG--GGGGGGGGG 179 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G G G G GGG G G GGG Sbjct: 91 GGGGSSGGRGGFGGGGGRGGGRGGG 115 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GGG G GGGG Sbjct: 154 GGGGYSGGGGGGRYGSGGGGGGG 176 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PPPP P PPPP + PPP P PP Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPP----SHSPPPPVYSPPPPTF 637 Query: 431 XPP 439 PP Sbjct: 638 SPP 640 Score = 33.9 bits (74), Expect = 0.16 Identities = 23/94 (24%), Positives = 23/94 (24%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P P P A PPP P P Sbjct: 534 PPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHS 593 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P PP P P P PP Sbjct: 594 PPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPP 627 Score = 32.7 bits (71), Expect = 0.37 Identities = 23/92 (25%), Positives = 25/92 (27%), Gaps = 3/92 (3%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP---PPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP + PP PP P + PPP P PP P Sbjct: 523 PPPPKVEDTRVPPPQPPMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASP 582 Query: 437 PXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P P PP P Sbjct: 583 PPPSPPPPVHSPPPPPVFSPPPPVFSPPPPSP 614 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 33.9 bits (74), Expect(2) = 0.009 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXG 457 PPPP A PPP + PPP PP G Sbjct: 27 PPPPMRRSAPSPPPMSGRVPPPPPPPPMFDPKG 59 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP 409 PPPP P P PPP P Sbjct: 150 PPPPPPMPRRSPPPPPP 166 Score = 28.7 bits (61), Expect = 6.0 Identities = 20/71 (28%), Positives = 23/71 (32%), Gaps = 3/71 (4%) Frame = +2 Query: 392 PPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP---XXLXRXPPXP*IXGGGKTXP 562 PPP PPP PP P L R IP + P P + G P Sbjct: 641 PPPSMSGGAPPPPPPPPMLVASRTAPPPHLSHVRSIPFQTRLVMGTSPLPLLVREGAPPP 700 Query: 563 LLXXIFXKGPP 595 L + PP Sbjct: 701 TLPSMSGGAPP 711 Score = 23.0 bits (47), Expect(2) = 0.009 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 251 PXPPXPPPP 277 P PP PPPP Sbjct: 22 PLPPPPPPP 30 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 37.9 bits (84), Expect = 0.010 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P A PPP P P P PP G P PP Sbjct: 384 PPPPPPPSAAAPPP-PPPPKKGPAAPPPPPPPGKKGAGPPPPP 425 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP---XPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PPPP PA PPP P PPP P G P P G Sbjct: 398 PPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKSG 446 Score = 31.9 bits (69), Expect = 0.65 Identities = 21/64 (32%), Positives = 22/64 (34%), Gaps = 6/64 (9%) Frame = +2 Query: 359 PPPPXPXPAXXPPP------XAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRX 520 P PP P PPP AP P PPP P G G P P + Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPP-PPMSKKG 431 Query: 521 PPXP 532 PP P Sbjct: 432 PPKP 435 Score = 29.9 bits (64), Expect = 2.6 Identities = 20/60 (33%), Positives = 20/60 (33%), Gaps = 3/60 (5%) Frame = +2 Query: 362 PPPXPXPA---XXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PA PPP P PP PP P PP P PP P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKK-------GPAAPPPPPPPGKKGAGPPPP 424 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 37.9 bits (84), Expect = 0.010 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP P P P PP Sbjct: 59 PPPPSPPPPSPPPPACPPPPALPPPPP 85 Score = 27.1 bits (57), Expect(2) = 0.20 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P P PP PPPP P Sbjct: 62 PSPPPPSPPPPACPP 76 Score = 25.4 bits (53), Expect(2) = 0.20 Identities = 13/40 (32%), Positives = 13/40 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG 478 PPPP P PP P PP G PG Sbjct: 69 PPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPG 108 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 37.5 bits (83), Expect = 0.013 Identities = 27/96 (28%), Positives = 28/96 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P P P P PPP P PA PP AP P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPA---PPPAPKPVPC 98 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P PP + P P P Sbjct: 99 P-SPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSPKP 133 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/95 (28%), Positives = 28/95 (29%), Gaps = 9/95 (9%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP-PXAPXPXP 421 P P P P P P PP P P P PP P AP P P Sbjct: 52 PSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKP 111 Query: 422 -PPXXPPXXXXXGXXXGX-------PGLPPNRGIP 502 PP PP P P N+ IP Sbjct: 112 VPPHGPPPKPAPAPTPAPSPKPAPSPPKPENKTIP 146 Score = 34.7 bits (76), Expect = 0.092 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P P P P +P P PPP P P PP P PP P Sbjct: 35 PPKPQPKPPPAPSP-SPCPSPPPKPQPKPVP------PPACPPTPPKPQPKPAPPPEP 85 Score = 33.5 bits (73), Expect = 0.21 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P P PPP P P PPP P P P P + P P Sbjct: 25 PPGPSPCPSPPPK-PQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKP 79 Score = 31.9 bits (69), Expect = 0.65 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN-RGIPXXLXRXPPXP 532 PP P P P P +P P PPP P P PP + P PP P Sbjct: 15 PPGPSSKPVAPPGP-SPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTP 72 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G G+ GGG G G GGGG Sbjct: 108 GGRSGSGRGRGSGGGGGHGGGGGGGGG 134 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG +G G G G Sbjct: 123 GGHGGGGGGGGGRGGGGGSGNGEGYG 148 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G G G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNG 144 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-GXXAGXGXGGG 361 GG GGG G G GG G G G GGG Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGGG 152 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGG 139 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 G G G G G G AG G GGGG Sbjct: 47 GIGIGGGGSGSGAGAGSGSGGGG 69 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G G G G AG G G GG Sbjct: 41 GAGIGIGIGIGGGGSGSGAGAGSGSGG 67 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G G GGG G GGGG Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGG 140 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GGG G G G GG Sbjct: 126 GGGGGGGGGRGGGGGSGNGEGYGEGG 151 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 37.1 bits (82), Expect = 0.017 Identities = 32/113 (28%), Positives = 33/113 (29%), Gaps = 7/113 (6%) Frame = +2 Query: 245 PXPXPPXPP-----PPXXX--PXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX 403 P P PP PP PP P A PPP P PPP Sbjct: 49 PDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Query: 404 APXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXP 562 A P PPP P P PP P L P P + T P Sbjct: 109 AITPPPPPAITPPLSPPPPAITPP--PPLATTPPALPPKPLPPPLSPPQTTPP 159 Score = 36.3 bits (80), Expect = 0.030 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPPP P P P P P P PP P PP P + PP Sbjct: 31 PPPPPCICICNPGPPPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPP 86 Score = 32.7 bits (71), Expect = 0.37 Identities = 28/94 (29%), Positives = 28/94 (29%), Gaps = 9/94 (9%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPP-------- 400 P PP P PP P PPP PA PPP Sbjct: 85 PPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPP---PAITPPPPLATTPPA 141 Query: 401 XAPXPXPPPXXPPXXXXXGXXXGXPGL-PPNRGI 499 P P PPP PP P L PP GI Sbjct: 142 LPPKPLPPPLSPPQTTPPPPPAITPPLSPPLVGI 175 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P PPP P Sbjct: 262 PPPLPPQTLKPPPPQTTPPPPPAITP 287 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P PP PP Sbjct: 262 PPPLPPQTLKPPPPQTTPPPPPAITPP 288 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 37.1 bits (82), Expect = 0.017 Identities = 21/65 (32%), Positives = 22/65 (33%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P PPPP P P PPP + Sbjct: 69 PSPSPPPPPPPRPPPPPLSPGSET--TTWTTTTTSSVLPPPPPP-PPPPPPPSSTWDFWD 125 Query: 425 PXXPP 439 P PP Sbjct: 126 PFIPP 130 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/61 (31%), Positives = 20/61 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P PPPP P P+ P PP Sbjct: 74 PPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPP--PPPPPPPPSSTWDFWDPFIPPP 131 Query: 425 P 427 P Sbjct: 132 P 132 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXP 436 PP P P PPP P P PPP P Sbjct: 68 PPSPSP---PPPPPPRPPPPPLSP 88 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 16/58 (27%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPX----------------PXPPPXXPPXXXXXGXXXGXPGLPP 487 PPP P P PPP +P P PPP PP P +PP Sbjct: 73 PPPPPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPSSTWDFWDPFIPP 130 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 37.1 bits (82), Expect = 0.017 Identities = 23/74 (31%), Positives = 23/74 (31%), Gaps = 9/74 (12%) Frame = +2 Query: 245 PXPXPPXPP--PPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPX-------PAXXPP 397 P P PP P PP P PPPP P P PP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPP 100 Query: 398 PXAPXPXPPPXXPP 439 P P PPP PP Sbjct: 101 REPPPPPPPPEEPP 114 Score = 35.1 bits (77), Expect = 0.069 Identities = 21/57 (36%), Positives = 23/57 (40%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P+ PP P P P PP P LPP +P L PP P Sbjct: 41 PPPSPPPSPSSPPRLPPPF-PALFPP----------EPPLPPRFELPPPLFPPPPLP 86 Score = 32.7 bits (71), Expect = 0.37 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PP P PPP P PPP P PP Sbjct: 56 PPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Query: 425 P 427 P Sbjct: 116 P 116 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/62 (32%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGL----PPNRGIPXXLXRXPP 526 PPP P PPP P P PP P L PP P R PP Sbjct: 45 PPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPP 104 Query: 527 XP 532 P Sbjct: 105 PP 106 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 P PP P PPP P P P PP P PP Sbjct: 65 PEPPLPPRFELPPPLFPPPPLPRLPPPLLPPPEEPPREPPPPP 107 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTG 494 PP PPPP PPP SP G Sbjct: 99 PPREPPPPPPPPEEPPPPASCLRTKSPENG 128 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 37.1 bits (82), Expect = 0.017 Identities = 22/62 (35%), Positives = 22/62 (35%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G GGG G G GGG G GGGG GG Sbjct: 113 GYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDG----GNGGGGPGYGSGGGGIGG 168 Query: 255 XG 250 G Sbjct: 169 GG 170 Score = 37.1 bits (82), Expect = 0.017 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G+ GGG G G GGG Sbjct: 150 GGNGGGGPGYGSGGGGIGGGGGIGGG 175 Score = 33.1 bits (72), Expect = 0.28 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXG-GGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GG G G G GG G G GGGG G GG G Sbjct: 100 GELTAGGYGGGGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGY 159 Query: 261 GGXGXG 244 G G G Sbjct: 160 GSGGGG 165 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/75 (32%), Positives = 24/75 (32%), Gaps = 4/75 (5%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAGXGXG-GGGXXXXXXXXXXXAXXXXXXXXXXXGXX 280 P G GGG G GGG G G G GGG G Sbjct: 112 PGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNGGGGPGYGSGGGGIGGGGG 171 Query: 279 XGGG---GXGGXGXG 244 GGG G GG G G Sbjct: 172 IGGGVIIGGGGGGCG 186 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG GGGG Sbjct: 169 GGGIGGGVIIGGGGGGCGGSCSGGGGG 195 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 5/38 (13%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAX-----GGGXXAGXGXGGGG 358 P GG GGG G G GGG G GGGG Sbjct: 157 PGYGSGGGGIGGGGGIGGGVIIGGGGGGCGGSCSGGGG 194 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/29 (48%), Positives = 14/29 (48%), Gaps = 3/29 (10%) Frame = -3 Query: 438 GGXXGG---GXGXGAXGGGXXAGXGXGGG 361 GG GG G G G GG G G GGG Sbjct: 170 GGIGGGVIIGGGGGGCGGSCSGGGGGGGG 198 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 36.7 bits (81), Expect = 0.023 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGG-GGX 262 GG GGG G G G G G G G GG G GG GG Sbjct: 123 GGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYGGS 182 Query: 261 GGXGXG 244 G G G Sbjct: 183 GAGGYG 188 Score = 32.3 bits (70), Expect = 0.49 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G G GGG G GGG GG G Sbjct: 122 GGGFGGG-GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGGNAAGGYG 180 Query: 258 GXGXG 244 G G G Sbjct: 181 GSGAG 185 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 36.7 bits (81), Expect = 0.023 Identities = 27/108 (25%), Positives = 29/108 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PP P PPP P P PP P P P Sbjct: 110 PHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTK--PPPSTPKPPHHKPPPTPCPPPT 167 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXPLL 568 P P PP P P P I T P++ Sbjct: 168 PTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVI 215 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/65 (26%), Positives = 17/65 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P P P P PP P PP P P PP Sbjct: 36 PHKPPKHPVKPPKPPAVKPPKPPAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPP 95 Query: 425 PXXPP 439 PP Sbjct: 96 TVKPP 100 Score = 31.5 bits (68), Expect = 0.86 Identities = 22/95 (23%), Positives = 24/95 (25%), Gaps = 1/95 (1%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP-PXPXPAXXPPPXAPXPXPPP 427 P PP PPP PPP P P P PP P P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITP 187 Query: 428 XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P + P P + P P Sbjct: 188 PTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTP 222 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/66 (27%), Positives = 18/66 (27%), Gaps = 1/66 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP-PXAPXPXP 421 P P PP PP P PP P PP P P P Sbjct: 178 PTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTP 237 Query: 422 PPXXPP 439 P PP Sbjct: 238 PTPTPP 243 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/94 (21%), Positives = 22/94 (23%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PP P PP P P PP P P Sbjct: 139 PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPP 198 Query: 431 XPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P + P P + P P Sbjct: 199 TPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTP 232 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPX--PXPPPXXPP 439 PP P PA PP P P PP PP Sbjct: 29 PPKPSPAPHKPPKHPVKPPKPPAVKPP 55 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP-PXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P PP P PPP P P P P P PP Sbjct: 104 PPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPP 159 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/97 (22%), Positives = 24/97 (24%), Gaps = 3/97 (3%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP---PPXPXPAXXPPPXAPXPXP 421 P P P PP P PP PP P P PP P Sbjct: 146 PPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVI 205 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P + P P + P P Sbjct: 206 TPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTP 242 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/68 (26%), Positives = 18/68 (26%), Gaps = 3/68 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXX---AXXXXXXXXXXXPPPPXPXPAXXPPPXAPXP 415 P PP P PP P PP P P P P P Sbjct: 58 PAVKPPTPKPPTVKPHPKPPTVKPHPKPPTVKPHPKPPTVKPPHPKPPTKPHPHPKPPIV 117 Query: 416 XPPPXXPP 439 PP PP Sbjct: 118 KPPTKPPP 125 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/64 (26%), Positives = 17/64 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP P PP P PP P PP P P P Sbjct: 183 PVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTP-PTPT 241 Query: 425 PXXP 436 P P Sbjct: 242 PPTP 245 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 36.7 bits (81), Expect = 0.023 Identities = 25/80 (31%), Positives = 28/80 (35%), Gaps = 2/80 (2%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPP-XXPPXXXXXGXXXGXPGL-PPNRGIPXXLXRXPPXP* 535 PP P P+ PPP P P PPP P P L PP+ P L P P Sbjct: 82 PPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQLPDPR 141 Query: 536 IXGGGKTXPLLXXIFXKGPP 595 P+ I PP Sbjct: 142 PNDNNILEPINNPISLPSPP 161 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P PP PP Sbjct: 68 PPPNQPPNTTPPPTPPSSPPPSITPP 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/63 (26%), Positives = 18/63 (28%), Gaps = 2/63 (3%) Frame = +2 Query: 245 PXPXPPXPPPP--XXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P P PP PPP P P P P P+ PPP Sbjct: 78 PPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLPPPSLFPPPSLVNQL 137 Query: 419 PPP 427 P P Sbjct: 138 PDP 140 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 36.3 bits (80), Expect = 0.030 Identities = 23/67 (34%), Positives = 25/67 (37%), Gaps = 4/67 (5%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR--GIPXXLXRXPPXP-- 532 PP P P PPP PP P G PG PP+ P PP P Sbjct: 65 PPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPSTMYSPPYPYFYTPPYPYG 124 Query: 533 *IXGGGK 553 I GGG+ Sbjct: 125 TIGGGGQ 131 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P P PP P PPP PP P R +P PP P Sbjct: 24 PPPPPPPP---PPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 1/60 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXP-PPXAPXPXP 421 P P PP PPPP P PPPP P PP P P P Sbjct: 22 PLPPPPPPPPP---PMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 4/60 (6%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXP----PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP PPP P P P P PP P PP L R PP P Sbjct: 15 PPMRGRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPP 74 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/62 (32%), Positives = 21/62 (33%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G GGG +G G G G G GG G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGG 145 Query: 255 XG 250 G Sbjct: 146 GG 147 Score = 33.1 bits (72), Expect = 0.28 Identities = 22/68 (32%), Positives = 22/68 (32%), Gaps = 3/68 (4%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGG-- 265 GG GG G G GG G GGGG G GGGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRR 149 Query: 264 -XGGXGXG 244 GG G G Sbjct: 150 EGGGYGGG 157 Score = 32.3 bits (70), Expect = 0.49 Identities = 21/69 (30%), Positives = 24/69 (34%), Gaps = 4/69 (5%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXG----XGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGG 271 GG G G G + GGG +G G GGGG + G G Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGGGGGRGYGGGGRREG 151 Query: 270 GGXGGXGXG 244 GG GG G Sbjct: 152 GGYGGGDGG 160 >At4g11660.1 68417.m01864 heat shock factor protein 7 (HSF7) / heat shock transcription factor 7 (HSTF7) identical to heat shock factor protein 7 (HSF7) SP:Q9T0D3 from [Arabidopsis thaliana] Length = 377 Score = 36.3 bits (80), Expect = 0.030 Identities = 15/26 (57%), Positives = 16/26 (61%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GG G GA GGG +G G GGGG Sbjct: 25 GNSGGSSGCGAGGGGGGSGGGGGGGG 50 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G A G +G G GGGG Sbjct: 14 GVGGGGAGCSAGNSGGSSGCGAGGGG 39 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GG G G GGGG Sbjct: 16 GGGGAGCSAGNSGGSSGCGAGGGGGG 41 >At2g28670.1 68415.m03485 disease resistance-responsive family protein / fibroin-related contains similarity to silk fibroin heavy chain [Bombyx mori] gi|765323|gb|AAB31861; contains disease resistance response protien domain Pfam:FP03018 Length = 447 Score = 36.3 bits (80), Expect = 0.030 Identities = 22/61 (36%), Positives = 22/61 (36%), Gaps = 1/61 (1%) Frame = -3 Query: 438 GGXXGGGXGXG-AXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GGG G G A GGG AG GGG A G GGGG Sbjct: 130 GSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAGAGPALGGGGA 189 Query: 261 G 259 G Sbjct: 190 G 190 Score = 30.7 bits (66), Expect = 1.5 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXG-AXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G G G G G A GGG AG GGG A GGG Sbjct: 120 GSATGAGAGTGSALGGGPGAGSALGGGAGAGPALGGGAGAGPALGGGAGAGSALGGGGAG 179 Query: 261 GGXGXG 244 G G Sbjct: 180 AGPALG 185 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G G G G GGG AG GGG Sbjct: 174 GGGGAGAGPALGGGGAGAGPALGGG 198 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 36.3 bits (80), Expect = 0.030 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAP-XPXP 421 P P PP P P PPP P PA PP P P P Sbjct: 75 PAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPP 134 Query: 422 PPXXPP 439 P PP Sbjct: 135 APASPP 140 Score = 35.5 bits (78), Expect = 0.053 Identities = 22/67 (32%), Positives = 22/67 (32%), Gaps = 3/67 (4%) Frame = +2 Query: 245 PXPXPPXPP--PPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX-PXPAXXPPPXAPXP 415 P PP PP PP P A PP P P PA PP AP Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVS 152 Query: 416 XPPPXXP 436 PP P Sbjct: 153 PPPVQAP 159 Score = 35.5 bits (78), Expect = 0.053 Identities = 19/63 (30%), Positives = 20/63 (31%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P P P PP P + P P P PA PPP P P P Sbjct: 93 PATPPPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPA-SPPPAPASPPPAPV 151 Query: 431 XPP 439 PP Sbjct: 152 SPP 154 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/64 (26%), Positives = 18/64 (28%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPP P + P P P P PP AP P Sbjct: 105 PASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISL 164 Query: 425 PXXP 436 P P Sbjct: 165 PPAP 168 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 35.9 bits (79), Expect = 0.040 Identities = 21/84 (25%), Positives = 21/84 (25%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP P P P PP P PP P P PP Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPT 470 Query: 431 XPPXXXXXGXXXGXPGLPPNRGIP 502 P G P P G P Sbjct: 471 SPTTPTPGGSPPSSPTTPTPGGSP 494 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/65 (26%), Positives = 18/65 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P + P PP P PP P P P Sbjct: 557 PIPSPPTPSTPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSP 616 Query: 425 PXXPP 439 P P Sbjct: 617 PPSTP 621 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/68 (26%), Positives = 20/68 (29%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 P PP P+ PP +P P PP G P P P P Sbjct: 456 PSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPS 515 Query: 539 XGGGKTXP 562 GG P Sbjct: 516 PGGSPPSP 523 Score = 31.5 bits (68), Expect = 0.86 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP PPP +P PP PP Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPP 784 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/60 (28%), Positives = 18/60 (30%), Gaps = 3/60 (5%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXP---XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P PPP + P PP P P P PP P Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPP 794 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 5/67 (7%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPP-----PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P PP + P PP P PP G P P P P Sbjct: 439 PPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSP 498 Query: 527 XP*IXGG 547 GG Sbjct: 499 TTPTPGG 505 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PP P PPPP + PPP PPP P Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPP--P 815 Query: 437 P 439 P Sbjct: 816 P 816 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/60 (28%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +2 Query: 359 PPPPXPX--PAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP P + PPP PPP PP + P + PP P Sbjct: 702 PPPPAPYYYSSPQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQSHPPCIEYSPPPP 761 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 35.9 bits (79), Expect = 0.040 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGGG Sbjct: 104 GGGYGGGTPGGGGGGGGDTGAGAGGGG 130 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G G G GGGG Sbjct: 109 GGTPGGGGGGGGDTGAGAGGGGYGGGG 135 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G GA GGG G G GG Sbjct: 115 GGGGGGDTGAGAGGGGYGGGGDTGAGG 141 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG G G G G GGG G G G G Sbjct: 119 GGDTGAGAGGGGYGGGGDTGAGGGVG 144 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 35.9 bits (79), Expect = 0.040 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = -3 Query: 435 GXXGGGXGXGAX--GGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GGG G G GGG G G GGGG GGGG Sbjct: 30 GGNGGGSGKGQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 Query: 261 GGXGXG 244 G G G Sbjct: 90 EGDGGG 95 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGA-XGGGXXAGXGXGGGG 358 GG GGG G G GGG G GGGG Sbjct: 46 GGEGGGGEGGGGEGGGGQKISKGGGGGG 73 Score = 31.5 bits (68), Expect = 0.86 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG + GGG G G GGGG Sbjct: 70 GGGGSGGGQRSSSGGGGGGGEGDGGGG 96 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 35.5 bits (78), Expect = 0.053 Identities = 25/100 (25%), Positives = 28/100 (28%), Gaps = 6/100 (6%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX---PXPAXXPPPXAPXP 415 P P PPPP P PPP P P PPP P Sbjct: 69 PPPIKKYPPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPPPIKKYP 128 Query: 416 XPPPXXPPXXXXXGXXXGXPGL---PPNRGIPXXLXRXPP 526 P PP P + PP P + + PP Sbjct: 129 PPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYPP 168 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P PPP P PP PP PP + P P P Sbjct: 206 PPPIKKYPPPEEYPPPIKTYPHPPVKYPPPPYKTYPHPPIKTYPPPKECPPPPEHYPWPP 265 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/100 (23%), Positives = 27/100 (27%), Gaps = 6/100 (6%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPX---PXPAXXPPPXAPXP 415 P P PPP P + PPP P P PPP P Sbjct: 108 PPPIKKYPPPEQYPPPIKKYPPPEQYSPPFKKYPPPEQYPPPIKKYPPPEHYPPPIKKYP 167 Query: 416 XPPPXXPPXXXXXGXXXGXPGL---PPNRGIPXXLXRXPP 526 PP P + PP P + + PP Sbjct: 168 PQEQYPPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPP 207 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P PPP P PP PP Sbjct: 56 PPPIEKYPPPVQYPPPIKKYPPPPYEHPP 84 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 6/64 (9%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPG----LPPNRGIPXXLXRX 520 PPP P P PPP P P PP P PP + P + Sbjct: 173 PPPIKKYPPPEKYPPPIKKYPPPEQYPPPIKKYPPPIKKYPPPEEYPPPIKTYPHPPVKY 232 Query: 521 PPXP 532 PP P Sbjct: 233 PPPP 236 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP PA PPP P P PP PP Sbjct: 265 PPPP---PAAAPPPQPPPPPPPKPQPP 288 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PPP P P P P PP Sbjct: 266 PPPPAAAPPPQPPP-PPPPKPQPPPPP 291 Score = 33.5 bits (73), Expect = 0.21 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P PPP P P P Sbjct: 278 PPPPPPKPQPPPPPKIARPPPAP 300 Score = 32.7 bits (71), Expect = 0.37 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P PPP PPP P Sbjct: 277 PPPPPPPKPQPPPPPKIARPPPAPP 301 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 PP PP AP P PPP PP Sbjct: 259 PPGRSAPPPPPAAAPPPQPPPPPPP 283 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/57 (33%), Positives = 20/57 (35%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PP P PPP PP P PP P + R PP P Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPP------KPQPPP----PPKIARPPPAP 300 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGG Sbjct: 125 GGYSGGGGGYGGGGGGYGGGGGGYGGG 151 Score = 35.5 bits (78), Expect = 0.053 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGGG Sbjct: 131 GGGYGGGGGGYGGGGGGYGGGGDGGGG 157 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGG Sbjct: 130 GGGGYGGGGGGYGGGGGGYGGGGDGGG 156 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G G GGGG Sbjct: 122 GGGGGYSGGGGGYGGG-GGGYGGGGGG 147 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 35.5 bits (78), Expect = 0.053 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +2 Query: 359 PPPPXPX----PAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPPP P PA PPP P PP PP P PP + PP Sbjct: 55 PPPPTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFP--PPQAYQAYYYRKSPP 112 Query: 527 XP 532 P Sbjct: 113 PP 114 Score = 31.9 bits (69), Expect = 0.65 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 3/48 (6%) Frame = +2 Query: 359 PPPPXPX---PAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 PPPP P PA PPP P P PP P PP++ Sbjct: 70 PPPPTPYYSPPADLPPPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSK 117 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/58 (32%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP--XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P P PA PPP P PPP PP P PP P + PP Sbjct: 44 PSPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSPPADLP--PPTPIYPPPVAFPPP 99 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 35.5 bits (78), Expect = 0.053 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P P P P P PPP P Sbjct: 54 PPPPPLPDFAPQPLLPPPSPPPPPP 78 >At1g13020.1 68414.m01510 eukaryotic translation initiation factor, putative (EIF4B5) eukaryotic initiation factor 4B (GI:6739522) {Arabidopsis thaliana}; EST gb|T22808 comes from this gene Length = 549 Score = 35.5 bits (78), Expect = 0.053 Identities = 17/28 (60%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXG-GGXXAGXGXGGGG 358 GG GGG G GA GG AG G GGGG Sbjct: 189 GGSFGGGGGGGAGSYGGGGAGAGSGGGG 216 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G GGG AG GGG Sbjct: 182 GSRYGGGGGSFGGGGGGGAGSYGGGG 207 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 35.1 bits (77), Expect = 0.069 Identities = 19/49 (38%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 359 PPPPXPXPAXX----PPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 PPPP P PP P P PPP PP G LPP R Sbjct: 9 PPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPPPRLGPRLRLRLLPPPR 57 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/40 (35%), Positives = 15/40 (37%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXP 524 PP PPPP PPP R PP + L P Sbjct: 29 PPPPPPPPPPPPPPRLGPRLRLRLLPPPRQQLLRLRKQQP 68 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 35.1 bits (77), Expect = 0.069 Identities = 16/27 (59%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 585 GGYGGGGGGYGG-GGGYGGGGGYGGGG 610 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G GGG G G GGGG Sbjct: 578 GSFGSGRGGYGGGGGGYGGGGGYGGGG 604 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G G GGG G G GGG Sbjct: 589 GGGGGYGGGGGYGGGGGYGGGGGYGGG 615 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 2/27 (7%) Frame = -3 Query: 438 GGXXGGGX--GXGAXGGGXXAGXGXGG 364 GG GGG G G GGG G G GG Sbjct: 592 GGYGGGGGYGGGGGYGGGGGYGGGYGG 618 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 35.1 bits (77), Expect = 0.069 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GG G G GGG + GGG G Sbjct: 109 GGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 168 Query: 258 GXGXG 244 G G G Sbjct: 169 GSGGG 173 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/64 (29%), Positives = 20/64 (31%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G GGG +G G G G G GGG G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGS 147 Query: 255 XGXG 244 G G Sbjct: 148 YGGG 151 Score = 32.3 bits (70), Expect = 0.49 Identities = 23/70 (32%), Positives = 23/70 (32%), Gaps = 5/70 (7%) Frame = -3 Query: 438 GGXXGGGXG--XGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGG- 268 GG GGG G GGG G G GGG G GGG Sbjct: 93 GGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGR 152 Query: 267 --GXGGXGXG 244 G GG G G Sbjct: 153 REGGGGYGGG 162 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 35.1 bits (77), Expect = 0.069 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PPP P PPP P P PPP P PPP Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP--PVASPPPA 103 Query: 431 XPP 439 PP Sbjct: 104 TPP 106 Score = 34.7 bits (76), Expect = 0.092 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P P PPPP P PPP P P PPP AP PP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVAS-PPPATPPPVATPPP-APLASPPAQ 122 Query: 431 XP 436 P Sbjct: 123 VP 124 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/96 (28%), Positives = 29/96 (30%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPP P + PPP P P PP A PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTA----PPPANPPPPVSSPPPAS---PP 83 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P PP P + PP P Sbjct: 84 PATPPPVASPPPPVASP--PP--ATPPPVATPPPAP 115 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PP P PP P PA P A P P P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPT 129 Query: 431 XPP 439 P Sbjct: 130 TKP 132 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 35.1 bits (77), Expect = 0.069 Identities = 19/63 (30%), Positives = 19/63 (30%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PPP P PPP P P PPP P PPP Sbjct: 46 PPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPPVASPPP--PVASPPPA 103 Query: 431 XPP 439 PP Sbjct: 104 TPP 106 Score = 34.7 bits (76), Expect = 0.092 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P P PPPP P PPP P P PPP AP PP Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVAS-PPPATPPPVATPPP-APLASPPAQ 122 Query: 431 XP 436 P Sbjct: 123 VP 124 Score = 34.3 bits (75), Expect = 0.12 Identities = 27/96 (28%), Positives = 29/96 (30%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPP P + PPP P P PP A PP Sbjct: 31 PAPPTPTTPPPAATPPPVSAPPPVTTSPPPVTTA----PPPANPPPPVSSPPPAS---PP 83 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P PP P + PP P Sbjct: 84 PATPPPVASPPPPVASP--PP--ATPPPVATPPPAP 115 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/63 (26%), Positives = 17/63 (26%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP PP P PP P PA P A P P P Sbjct: 70 PPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAPT 129 Query: 431 XPP 439 P Sbjct: 130 TKP 132 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 35.1 bits (77), Expect = 0.069 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G G GG G GGG G Sbjct: 79 GGHYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGGGHGGGGHYGGGGGGYGGGGGHHG 138 Query: 258 GXGXG 244 G G G Sbjct: 139 GGGHG 143 Score = 30.7 bits (66), Expect = 1.5 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAG-XGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GGG G G GG G G GGGG G GGGG Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGG--GGGHYGGGGGHYGGGGGH 109 Query: 261 GGXGXG 244 G G G Sbjct: 110 YGGGGG 115 Score = 30.3 bits (65), Expect = 2.0 Identities = 21/66 (31%), Positives = 21/66 (31%), Gaps = 2/66 (3%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXG--XGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GG G G GGG G G GGGG G GGGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Query: 261 GGXGXG 244 G G Sbjct: 102 HYGGGG 107 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P PPP P PP PP Sbjct: 147 PPPESPPPESLPPPSPESPSPPSPEPP 173 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 P PP P P PPP + P PPP Sbjct: 165 PSPPSPEP---PPPSSLEPPPPP 184 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 35.1 bits (77), Expect = 0.069 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P PP P P PPP P PPP P Sbjct: 98 PSPPPPLPTEAPPPANPVSSPPPESSP 124 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/94 (24%), Positives = 25/94 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P P P P PPP P + PPP + P PP Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSS--PPPESSPPPPP 128 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P P PP P L P Sbjct: 129 PTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDP 162 Score = 33.5 bits (73), Expect = 0.21 Identities = 23/90 (25%), Positives = 25/90 (27%), Gaps = 4/90 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPP P PPPP P+ P P PP Sbjct: 110 PPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPP 169 Query: 425 P-XXPPXXXXXGXXXGXPGL---PPNRGIP 502 P PP P PP R +P Sbjct: 170 PKLVPPSHSPPRHLPSPPASEIPPPPRHLP 199 Score = 32.3 bits (70), Expect = 0.49 Identities = 24/97 (24%), Positives = 27/97 (27%), Gaps = 4/97 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXP---PPPXPXPAXXPPPXAPXP 415 P PP P PP P + P PP P + PP P P Sbjct: 91 PVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPP 150 Query: 416 XPPPXXPPXXXXXGXXXGXPGL-PPNRGIPXXLXRXP 523 P P P L PP+ P L P Sbjct: 151 PESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPP 187 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/86 (23%), Positives = 23/86 (26%), Gaps = 1/86 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX-APXPXP 421 P P PP P P P PP P PPP +P P P Sbjct: 217 PSPPPPGHPKRREQPPPPGSKRPTPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLP 276 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGI 499 P P PP + + Sbjct: 277 SNSSSPPTLLPPSSVVSPPSPPRKSV 302 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/100 (24%), Positives = 27/100 (27%), Gaps = 4/100 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXX---PPPXAPXP 415 P P PP P P P + P P P+ PPP P Sbjct: 96 PEPSPPPPLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESPP 155 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPPNRGIP-XXLXRXPPXP 532 P PP P P R +P PP P Sbjct: 156 SLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIPPPP 195 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/97 (24%), Positives = 26/97 (26%), Gaps = 3/97 (3%) Frame = +2 Query: 251 PXPPX---PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P PP PPPP P + PPP P PPP P Sbjct: 184 PSPPASEIPPPPRHLPSPPASERP---STPPSDSEHPSPPPPGHPKRREQPPPPGSK-RP 239 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P PP +P P P Sbjct: 240 TPSPPSPSDSKRPVHPSPPSPPEETLPPPKPSPDPLP 276 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPX----PXPPPXXPP 439 PPPP P P PP P P PPP PP Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPPPPPP 342 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPP P PPP P PP PP P PP Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPP--PPPSVSKAPPPPPPPPPP 343 Score = 25.4 bits (53), Expect(2) = 6.7 Identities = 10/26 (38%), Positives = 10/26 (38%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 P PP P P PP PP P Sbjct: 29 PLPPPPPPPLKPPSSGSATTKPPINP 54 Score = 21.4 bits (43), Expect(2) = 6.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P P PPPP Sbjct: 25 PSPLPLPPPPP 35 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 34.7 bits (76), Expect = 0.092 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PPPP P + PPPP P PPP PPP P Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYP------PPPPLSPPPPSPPPPYIYSSPPPPSP 554 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP--PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP PPP P PP PP P PP P PP P Sbjct: 621 PPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPP 680 Score = 29.9 bits (64), Expect = 2.6 Identities = 23/97 (23%), Positives = 26/97 (26%), Gaps = 8/97 (8%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXA--------PXPXP 421 PPPP + PPPP P PPP + P P Sbjct: 471 PPPPSSKMSPSFRATPPPPSSKMSPSVKAYPPPPPPPEYEPSPPPPSSEMSPSVRAYPPP 530 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP PP PP+ P P P Sbjct: 531 PPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPP 567 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +2 Query: 359 PPPPXPX----PAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPPP P A PPP +P PP P P PN+ P PP Sbjct: 718 PPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPA-SPNQSPPPEYQSPPP 776 Score = 29.1 bits (62), Expect = 4.6 Identities = 19/63 (30%), Positives = 19/63 (30%), Gaps = 7/63 (11%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPP-------PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXP 523 PP P P PP A P PP PP P PP P P Sbjct: 632 PPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPP 691 Query: 524 PXP 532 P P Sbjct: 692 PSP 694 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/94 (25%), Positives = 25/94 (26%), Gaps = 3/94 (3%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPP---X 430 P PPPP P PPP P PP P PP Sbjct: 632 PPPPPPVYYPPVTASPPPPPV--YYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQS 689 Query: 431 XPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PP +P PP P Sbjct: 690 PPPSPVYYPPVTQSPPPPPVYYLPVTQSPPPPSP 723 >At1g53625.1 68414.m06096 expressed protein Length = 89 Score = 34.7 bits (76), Expect = 0.092 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGG Sbjct: 59 GGGDGGGDGGGDGGGGGCGGGGGCGGG 85 Score = 33.9 bits (74), Expect = 0.16 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GG G G GGG G G GGG Sbjct: 64 GGDGGGDGGGGGCGGGGGCGGGGGGG 89 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 34.7 bits (76), Expect = 0.092 Identities = 20/64 (31%), Positives = 21/64 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPPP P + PPPP P PPP PP Sbjct: 7 PENSPPAPPPPSP-PSPPSSNDQQTTSPPPSDNQETTSPPPPSS-PDIAPPPQQQQESPP 64 Query: 425 PXXP 436 P P Sbjct: 65 PPLP 68 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 34.3 bits (75), Expect = 0.12 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXX-----PPXXXXXGXXXGXPGLPPNRGIPXXLXRXP 523 PP P P P P PPP PP G PG+PP G P P Sbjct: 181 PPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHGMQGPPPSRPGMPPPGGAPMFAPPHP 240 Query: 524 PXP 532 P Sbjct: 241 GMP 243 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 34.3 bits (75), Expect = 0.12 Identities = 23/65 (35%), Positives = 23/65 (35%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G GGG G GGGG A G G GG G Sbjct: 358 GGGMGGAGGGGYRGGGGYDMGGVGGGG------AGGYGAGGGGNGGGSFYGGGGGRGGYG 411 Query: 258 GXGXG 244 G G G Sbjct: 412 GGGSG 416 Score = 31.9 bits (69), Expect = 0.65 Identities = 23/69 (33%), Positives = 23/69 (33%), Gaps = 4/69 (5%) Frame = -3 Query: 438 GGXXGGGXGXGAXG-GGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGG--- 271 GG GGG G G GG G G GG G G GG Sbjct: 254 GGGYGGGRSGGYGGYGGEFGGYGGGGYGGGVGPYRGEPALGYSGRYGGGGGGYNRGGYSM 313 Query: 270 GGXGGXGXG 244 GG GG G G Sbjct: 314 GGGGGYGGG 322 Score = 31.5 bits (68), Expect = 0.86 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G GG G GGGG G GGG G Sbjct: 343 GSYGGGYGSSGIGGYGGGMGGAGGGGYRGGGGYDMGGVGGGGAGGYGAGGGGNGGGSFYG 402 Query: 255 XGXG 244 G G Sbjct: 403 GGGG 406 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 34.3 bits (75), Expect = 0.12 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP 397 P P PP PPPP P PPPP P P PP Sbjct: 120 PPPPPPPPPPP---PTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 34.3 bits (75), Expect = 0.12 Identities = 18/52 (34%), Positives = 18/52 (34%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPP 400 P P PP PPPP P A PPPP P P PP Sbjct: 121 PPPPPPPPPPPTITP-----PVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 10/37 (27%) Frame = +2 Query: 359 PPPPXPXPAXX----------PPPXAPXPXPPPXXPP 439 PPPP P A PPP P P PPP P Sbjct: 99 PPPPPPLSAITTTGHHHHRRSPPPPPPPPPPPPTITP 135 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 120 PPPPPPPPPPPP 131 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 151 PPPPPPPPPPPP 162 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/56 (28%), Positives = 18/56 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P PP P P PPP P P P P PP +P + P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAPKKSP 143 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/65 (26%), Positives = 18/65 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P P P PP P P+ PP P P Sbjct: 88 PSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSPP-PTPSLPPPAPKKSPSTP 146 Query: 425 PXXPP 439 PP Sbjct: 147 SLPPP 151 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/23 (60%), Positives = 14/23 (60%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG G G GGGG Sbjct: 400 GGGGGGGDGGGGQGTGIGGGGGG 422 Score = 34.3 bits (75), Expect = 0.12 Identities = 16/28 (57%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXG-AXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 405 GGDGGGGQGTGIGGGGGGEQGTGVGGGG 432 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G GGG GGG G GGG Sbjct: 417 GGGGGGEQGTGVGGGGDTCTQVTHGGGGAPLTMIGGGGGEQGVTGSDGGGGRGRGGGKVA 476 Query: 258 GXG 250 G G Sbjct: 477 GGG 479 >At1g11850.2 68414.m01364 expressed protein Length = 108 Score = 34.3 bits (75), Expect = 0.12 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 75 GLGGGGGGLGGGGGGLLGGGGFGGG 99 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/64 (31%), Positives = 20/64 (31%), Gaps = 1/64 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG-GXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 GG G G G G GG G G G G G G GGG Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAGIGAGAGLGLGGGGGGLGGGGGGLLGGGGFGGGAG 101 Query: 261 GGXG 250 GG G Sbjct: 102 GGLG 105 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G G GG Sbjct: 80 GGGLGGGGGGLLGGGGFGGGAGGGLGG 106 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 30.7 bits (66), Expect(2) = 0.14 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP 421 PPPP P PPP P P P Sbjct: 103 PPPPQPLNLFSPPPPPPPPDP 123 Score = 22.2 bits (45), Expect(2) = 0.14 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PP P Sbjct: 98 PPPQPPPPPQP 108 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/56 (33%), Positives = 21/56 (37%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P PP P P +P P PPP PP P LPP +P PP Sbjct: 201 PLPPLPPTTGLTLPHSPFPPPPPGPPPKE----QDFVRPPLPPPPQLPQSSQPPPP 252 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/46 (32%), Positives = 17/46 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 P P P P PPP PP PP PGL ++G Sbjct: 214 PHSPFPPPPPGPPPKEQDFVRPPLPPPPQLPQSSQPPPPGLSGSQG 259 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PA P A P PPP PP PG P P + P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPG-PKGPRPPPPMSLGPKAP 424 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P P P P P PP G P P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 33.9 bits (74), Expect = 0.16 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PA P A P PPP PP PG P P + P P Sbjct: 370 PPPPVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPG-PKGPRPPPPMSLGPKAP 424 Score = 32.7 bits (71), Expect = 0.37 Identities = 15/43 (34%), Positives = 15/43 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P P P P P PP G P P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/61 (34%), Positives = 22/61 (36%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IX 541 P P P P P P PP P G PG+PP IP PP P I Sbjct: 331 PTLPPLPVLPPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPG----IPPAPLIP 386 Query: 542 G 544 G Sbjct: 387 G 387 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/51 (37%), Positives = 20/51 (39%), Gaps = 8/51 (15%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA--PXPXPP----PXXPPXXXXXGXXXG--XPGLPP 487 PP P P PPP P P PP P PP G PG+PP Sbjct: 340 PPVPIVNPPSLPPPPPSFPVPLPPVPGLPGIPPVPLIPGIPPAPLIPGIPP 390 >At3g50140.1 68416.m05481 expressed protein contains Pfam profile PF03140: Plant protein of unknown function Length = 508 Score = 33.9 bits (74), Expect = 0.16 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P PP P P PPP P Sbjct: 12 PPPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PP P P PPP P Sbjct: 11 PPPPPPPRLLVLPPLPPPPPPPPPQLP 37 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P P P PPP PP Sbjct: 10 PPPPPPPPRLLVLP--PLPPPPPPPPP 34 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP-XPPPXXPPXXXXXGXXXGXPGLPP 487 PP P PA PPP P PP PP G G PP Sbjct: 507 PPAGYPPPAGYPPPQYPQAGYPPAGYPPPQQGYGQGYPAQGYPP 550 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 33.9 bits (74), Expect = 0.16 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P PP P P + PPPP PPP AP PP Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPL 158 Query: 431 XPP 439 PP Sbjct: 159 TPP 161 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 33.9 bits (74), Expect = 0.16 Identities = 21/65 (32%), Positives = 21/65 (32%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPP P PPPP P P P P PP Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHY--------PPPPYHH-YITPSPPPPRPLPP 111 Query: 425 PXXPP 439 P PP Sbjct: 112 PPPPP 116 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 33.9 bits (74), Expect = 0.16 Identities = 17/58 (29%), Positives = 22/58 (37%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PPP +P P P PP PP+ + + PP P Sbjct: 513 PPPPYVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPP 570 Score = 33.5 bits (73), Expect = 0.21 Identities = 25/101 (24%), Positives = 27/101 (26%), Gaps = 5/101 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP P PP + PPPP + PP P PP Sbjct: 457 PPPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPP 516 Query: 425 -----PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P P P PP P Sbjct: 517 YVYSSPPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSP 557 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/71 (28%), Positives = 21/71 (29%), Gaps = 6/71 (8%) Frame = +2 Query: 245 PXPXPPXPPPP-----XXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP-PXA 406 P P PP PPPP P PP P P PP + Sbjct: 522 PPPPPPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSPVYYPPVTNS 581 Query: 407 PXPXPPPXXPP 439 P P P PP Sbjct: 582 PPPPSPVYYPP 592 Score = 30.3 bits (65), Expect = 2.0 Identities = 22/92 (23%), Positives = 26/92 (28%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PP P + PPPP P P A P PPP Sbjct: 407 PPPPPSSKMSPTVRAYSPPPPPSSKMSPSVRAYSPPPP-PYSKMSPSVRAYPPPPPPSPS 465 Query: 437 PXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P + + P + PP P Sbjct: 466 PPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPP 497 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPP-PXAPXPXPPPXXPP 439 P PP P P PP +P P P PP Sbjct: 625 PSPPPPSPVYYPPVTPSPPPPSPVYYPP 652 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXG 469 P P P PP P P PPP PP G G Sbjct: 17 PQGPPPPVGVPPQYYPPPPPPPPPPPPPRKVGFLEG 52 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PP P P PPP PP Sbjct: 20 PPPPVGVPPQYYPPPPPPPPPPP--PP 44 >At4g16240.1 68417.m02464 hypothetical protein Length = 42 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GGG G G GGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GG G GGGG Sbjct: 12 GGAGGGGGHGGGAGGGFGGGAGGGGG 37 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 33.5 bits (73), Expect = 0.21 Identities = 24/78 (30%), Positives = 27/78 (34%), Gaps = 2/78 (2%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXPPXXXXXG--XXXGXPGLPPNRGIPXXLXRXPPXP*IX 541 P P P P P P P PP G G P PP+ P R P + Sbjct: 78 PRPSPMARPGPPPPAAMARPGGPPQVSQPGGFPPVGRPVAPPSNQPPFG-GRPSTGP-LV 135 Query: 542 GGGKTXPLLXXIFXKGPP 595 GGG + P GPP Sbjct: 136 GGGSSFPQPGGFPASGPP 153 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.5 bits (73), Expect = 0.21 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P A PPP PPP P Sbjct: 232 PPPPPPHQAQPPPPPPSGLFPPPPPP 257 Score = 33.1 bits (72), Expect = 0.28 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P PPP P PP PP Sbjct: 231 PPPPPPPHQAQPPPPPPSGLFPPPPPP 257 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G GGG G G GGGG Sbjct: 54 GGGGGGAWGGEGEGGGEWGGGGEGGGG 80 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG GA GGG G G GGG Sbjct: 35 GGAGGGEWGGAEGGGAWGGGGGGGG 59 Score = 32.7 bits (71), Expect = 0.37 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G GA GGG G GG G Sbjct: 39 GGEWGGAEGGGAWGGGGGGGGAWGGEG 65 Score = 32.3 bits (70), Expect = 0.49 Identities = 15/27 (55%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -3 Query: 438 GGXXGGGX-GXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G G GGG Sbjct: 43 GGAEGGGAWGGGGGGGGAWGGEGEGGG 69 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GG G G GGG Sbjct: 48 GGAWGGGGGGGGAWGGEGEGGGEWGGG 74 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GA GG G GGGG Sbjct: 49 GAWGGGGGGGGAWGGEGEGGGEWGGGG 75 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 33.5 bits (73), Expect = 0.21 Identities = 22/66 (33%), Positives = 22/66 (33%), Gaps = 2/66 (3%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXG--XGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGX 262 G GG G G GGG G G GGGG G GGGG Sbjct: 42 GYGGGHGGHGGHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGG 101 Query: 261 GGXGXG 244 G G G Sbjct: 102 GYGGGG 107 Score = 33.5 bits (73), Expect = 0.21 Identities = 20/65 (30%), Positives = 20/65 (30%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 G GGG G G GG G GGG G GGG G Sbjct: 52 GHGGGGGHGHGGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGGYGGGGGHHG 111 Query: 258 GXGXG 244 G G G Sbjct: 112 GGGHG 116 >At1g53600.1 68414.m06090 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 839 Score = 33.5 bits (73), Expect = 0.21 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 790 GHHGGGGGGCGGCGGGGCGGGGDGGG 815 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G GGGG Sbjct: 780 GHHGGGGCGGGHHGGGGGGCGGCGGGG 806 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/28 (53%), Positives = 15/28 (53%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGG-GXXAGXGXGGGG 358 GG GGG G GG G G G GGGG Sbjct: 784 GGGCGGGHHGGGGGGCGGCGGGGCGGGG 811 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 31.9 bits (69), Expect = 0.65 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P P PPP + P P PP Sbjct: 1133 PPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P PPP PP Sbjct: 1126 PPLPHESPPS-PPPQPPSSPPPPSSPP 1151 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 PP P + PP P PPP P LPP Sbjct: 1126 PPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPPSDHCLPP 1166 Score = 27.9 bits (59), Expect(2) = 0.28 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +2 Query: 359 PPPPXPXPAXXP-PPXAPXPXPPPXXP 436 PPPP P P PP + PPP P Sbjct: 1144 PPPPSSPPQLAPAPPPSDHCLPPPTAP 1170 Score = 23.8 bits (49), Expect(2) = 0.28 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P P PP PPP P Sbjct: 1136 PPPQPPSSPPPPSSP 1150 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GGG G G GGG Sbjct: 69 GSGGGGGGRGYGGGGRREGGGYGGG 93 >At2g35920.1 68415.m04409 helicase domain-containing protein similar to DEIH-box RNA/DNA helicase [Arabidopsis thaliana] GI:5881579; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 995 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GG G G GGGG Sbjct: 10 GGRRGGGHSSGRRGGRGGGGRGGGGGG 36 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 33.1 bits (72), Expect = 0.28 Identities = 14/29 (48%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXA--PXPXPPPXXPP 439 PPPP P PPP + P PPP PP Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPPP P PPP P P P P PP P L PP Sbjct: 35 PPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPP-PPPPSAPPPLVPDPP 89 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PP P P P+ P P P PPP Sbjct: 31 PPVPPPPPSHQPYSYPPPPPPPP 53 Score = 29.5 bits (63), Expect = 3.5 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +2 Query: 359 PPPPXPXPAXX---PPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 P PP P P PP P PPP PP P PP Sbjct: 7 PYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPPPPP 52 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/65 (27%), Positives = 18/65 (27%), Gaps = 1/65 (1%) Frame = +2 Query: 245 PXPXPP-XPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 P P PP PPP P P P PPP P P Sbjct: 22 PPPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPPPPPPSAP 81 Query: 422 PPXXP 436 PP P Sbjct: 82 PPLVP 86 >At1g48100.1 68414.m05368 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from [Glycine max]; contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 475 Score = 28.7 bits (61), Expect(2) = 0.30 Identities = 13/34 (38%), Positives = 13/34 (38%), Gaps = 1/34 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP-XPXPPPXXPPXXXXXG 457 PPPP P PP P P P P P G Sbjct: 44 PPPPPPLETANPPDQVPSDPYPSPDPAPGDSDSG 77 Score = 23.0 bits (47), Expect(2) = 0.30 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 251 PXPPXPPPP 277 P PP PPPP Sbjct: 41 PLPPPPPPP 49 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 32.7 bits (71), Expect = 0.37 Identities = 19/61 (31%), Positives = 19/61 (31%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 GGG G GGG GGGG G GGGG GG Sbjct: 340 GGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPMS 399 Query: 246 G 244 G Sbjct: 400 G 400 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAG---XGXGGGG 358 P GG GGG G G GG G G GGGG Sbjct: 380 PNGGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGG 415 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 8/35 (22%) Frame = -3 Query: 438 GGXXGGGXGXG--------AXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G GGG G G GGGG Sbjct: 111 GGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At3g14480.1 68416.m01834 glycine/proline-rich protein contains 1 predicted transmembrane domain; Length = 175 Score = 32.7 bits (71), Expect = 0.37 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GG G G GGG G G GGGG Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGG 167 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G G GGG G G GGG Sbjct: 145 GGSHGHGCGGGGGGGGGGLGGGGCGGG 171 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 G GGG G G GGG G G GG Sbjct: 151 GCGGGGGGGGGGLGGGGCGGGGCGG 175 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 32.7 bits (71), Expect = 0.37 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG G G G GGG G GGGG G GGGG Sbjct: 45 GGHGGHGGGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGGGHGGGGHY 104 Query: 258 GXG 250 G G Sbjct: 105 GGG 107 Score = 32.3 bits (70), Expect = 0.49 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G GGGG Sbjct: 82 GGHYGGGGGHYGGGGGHGGGGHYGGGG 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGG Sbjct: 89 GGHYGGGGGHG--GGGHYGGGGHHGGG 113 >At4g21720.1 68417.m03145 expressed protein Length = 139 Score = 30.3 bits (65), Expect(2) = 0.43 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P PPP + P PP Sbjct: 109 PPPPKPQPPP-PPPRSQKPMQPP 130 Score = 21.0 bits (42), Expect(2) = 0.43 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P P PPPP P Sbjct: 104 PKRPPPPPPKPQP 116 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P PPP P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXP 436 P P P PPP P PPP P Sbjct: 365 PVPPPRRSPPPLQTPPPPPPPPP 387 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P P P PP Sbjct: 368 PPRRSPPPLQTPPPPPPPPPLAPPPPP 394 Score = 28.7 bits (61), Expect(2) = 0.48 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP 415 PPPP P P PPP P Sbjct: 380 PPPPPPPPLAPPPPPQKRP 398 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P PPP P PP P Sbjct: 373 PPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 22.2 bits (45), Expect(2) = 0.48 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P PP PPPP Sbjct: 375 PLQTPPPPPPP 385 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 32.3 bits (70), Expect = 0.49 Identities = 22/86 (25%), Positives = 23/86 (26%), Gaps = 4/86 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP----PXPXPAXXPPPXAPX 412 P P P P PP P PP P P A PPP Sbjct: 35 PPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVI 94 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPP P P PP+ Sbjct: 95 ASPPPSTPATTPPAPPQTVSPPPPPD 120 Score = 30.7 bits (66), Expect = 1.5 Identities = 24/99 (24%), Positives = 25/99 (25%), Gaps = 3/99 (3%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPP P A PPPP P P P P Sbjct: 80 PPPTVASSPPP---PVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPK 136 Query: 425 PXXPPXXXXXGXXXGXPGLP---PNRGIPXXLXRXPPXP 532 P P P P P+ P PP P Sbjct: 137 PSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPP 175 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P PPP P P PP PP Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPPP 50 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 2/67 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP--PXAPXPX 418 P P PPP P PP PA PP P P Sbjct: 57 PPPVVSSPPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSPP 116 Query: 419 PPPXXPP 439 PPP P Sbjct: 117 PPPDASP 123 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/65 (26%), Positives = 18/65 (27%), Gaps = 3/65 (4%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP---PXAPXPXP 421 P P P PP P PPP P + PP P P Sbjct: 134 PPKPSPSPPGETPSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDPSTLA 193 Query: 422 PPXXP 436 PP P Sbjct: 194 PPPTP 198 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 32.3 bits (70), Expect = 0.49 Identities = 22/74 (29%), Positives = 27/74 (36%), Gaps = 7/74 (9%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPP------XXPPXXXXXGXXXGXPGLPPN-RGIPXXLXRX 520 PPP P PPP + PPP PP P L P+ +G P + Sbjct: 67 PPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSPDGKGSPPSVPSS 126 Query: 521 PPXP*IXGGGKTXP 562 PP P G+ P Sbjct: 127 PPSPKGQSQGQQQP 140 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPP--PXAPXPXPPPXXPP 439 PPP P P+ PP P P PP PP Sbjct: 44 PPPSKPSPSMSPPPSPSLPLSSSPPPPPP 72 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 32.3 bits (70), Expect = 0.49 Identities = 19/65 (29%), Positives = 19/65 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P P PPP P PP P PA PP AP P Sbjct: 24 PAPTPTATPPPATPPPVATPPPVATPPPAATPAPATP-PPAATPAPATTPPSVAPSPADV 82 Query: 425 PXXPP 439 P P Sbjct: 83 PTASP 87 Score = 30.7 bits (66), Expect = 1.5 Identities = 16/52 (30%), Positives = 16/52 (30%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXP 523 P P P PPP P P P PP P PP P P Sbjct: 24 PAPTPTATPPPATPPPVATP--PPVATPPPAATPAPATPPPAATPAPATTPP 73 >At4g08230.1 68417.m01358 glycine-rich protein Length = 113 Score = 32.3 bits (70), Expect = 0.49 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAGXGXGGG 361 P GG GGG G G GGG G G GGG Sbjct: 54 PNKKWGGGMGGGGGGGGGSGGG---GGGRGGG 82 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG G G G GG Sbjct: 59 GGGMGGGGGGGGGSGGGGGGRGG 81 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GGG G G GGG G GG Sbjct: 63 GGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G+ GGG G G GG Sbjct: 61 GMGGGGGGGGGSGGGGGGRGGGPPRGG 87 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GG G G GGG G G GGG Sbjct: 60 GGMGGGGGGGGGSGGGGGGRGGG 82 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 32.3 bits (70), Expect = 0.49 Identities = 25/101 (24%), Positives = 27/101 (26%), Gaps = 5/101 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP- 421 P P P P P A PPP + PPP +P P Sbjct: 5 PSPGTTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSL 64 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXL----XRXPPXP 532 PP PP P P P R PP P Sbjct: 65 PPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSP 105 Score = 32.3 bits (70), Expect = 0.49 Identities = 18/57 (31%), Positives = 19/57 (33%), Gaps = 1/57 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP-XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PPP P P PPP P PP P P P N P + PP Sbjct: 54 PPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTPSNPRSPPSPNQGPP 110 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP 415 PPP P P PPP P P Sbjct: 217 PPPKPPSPPRKPPPPPPPP 235 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 224 PPRKPPPPPPPP 235 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P P P P P P P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPP P P PP P PPP P Sbjct: 72 PPPKP-PEPPKPPEPEKPKPPPAPEP 96 Score = 27.1 bits (57), Expect(2) = 1.6 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PP AP P PP Sbjct: 79 PPKPPEPEKPKPPPAPEPPKHVCKPP 104 Score = 22.2 bits (45), Expect(2) = 1.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PP P Sbjct: 72 PPPKPPEPPKP 82 >At1g35230.1 68414.m04369 arabinogalactan-protein (AGP5) identical to gi_3883128_gb_AAC77827 Length = 133 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXPP 439 P P P+ PPP AP PP PP Sbjct: 48 PAPSPSANPPPSAPTTAPPVSQPP 71 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 32.3 bits (70), Expect = 0.49 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 P P PPP P P PPP PP Sbjct: 25 PVTPVNTVRPPPSQPPPAPPPLPPP 49 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 25.4 bits (53), Expect(2) = 0.63 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 369 PLPPPPPPPPP 379 Score = 25.0 bits (52), Expect(2) = 0.63 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = +2 Query: 359 PPPPXPXPAXXPPP 400 PPPP P P+ PP Sbjct: 374 PPPPPPSPSTSSPP 387 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 31.9 bits (69), Expect = 0.65 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXG--GGG 358 G GGG G G GGG +G G G GGG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGG 113 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G GGG +G G GGG Sbjct: 100 GYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G + GGG G GGGG Sbjct: 99 GGYRSGGGGGYSGGGGGGYSGGGGGGG 125 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG G G G + GGG +G G GG Sbjct: 92 GGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GG G GGGG Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGG 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G GGGG Sbjct: 98 GGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 31.9 bits (69), Expect = 0.65 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GGG G G GGGG Sbjct: 126 GYSYGGGGGGYGGGGGGYGGGGDGGGG 152 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGG Sbjct: 125 GGYSYGGGGGGYGGGGGGYGGGGDGGG 151 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GGG G G GGG Sbjct: 124 GGGYSYGGGGGGYGGGGGGYGGG 146 >At2g30340.1 68415.m03692 LOB domain protein 13 / lateral organ boundaries domain protein 13 (LBD13) identical to LOB DOMAIN 13 [Arabidopsis thaliana] GI:17227158 SP|Q9AT61 Length = 268 Score = 31.9 bits (69), Expect = 0.65 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPP-XAPXPXPPPXXP 436 PPPP P P PP + P PPP P Sbjct: 193 PPPPPPPPTPRPPRLLSSQPAPPPTPP 219 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/30 (46%), Positives = 15/30 (50%), Gaps = 4/30 (13%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAP----XPXPPPXXPP 439 PPP P + PPP P P PPP PP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPP 96 Score = 29.9 bits (64), Expect = 2.6 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Frame = +2 Query: 359 PPPPXPXPAXXPPP----XAPXPXPPPXXPPXXXXXGXXXGXPGL---PPNRGIPXXLXR 517 PPPP P PPP P PPP PP P + PP P + Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPP--PPIYSPPPPPIYPPPIYSPPPPPIYPPPIYS 100 Query: 518 XPPXP 532 PP P Sbjct: 101 PPPTP 105 Score = 29.1 bits (62), Expect = 4.6 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPPP P PP P PP P PP G P Sbjct: 89 PPPPIYPPPIYSPPPTPISPPPKVHHPAPQAQKAFYYRQSPPPPSGQP 136 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.5 bits (68), Expect = 0.86 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 3/61 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP---XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPX 529 PPPP + PPP P PPP PP PP P + R PP Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRPPP---PPTITRSPPP 181 Query: 530 P 532 P Sbjct: 182 P 182 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP-XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PPP P PPP P P + + P L PP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP-XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PPP P PPP P P + + P L PP P Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPP 138 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 PPPP P PP P P PPP PP P PP++ Sbjct: 37 PPPP---PVYSPPISPPPPPPPP--PPQSHAAAYKRYSPPPPPSK 76 >At5g19750.1 68418.m02348 peroxisomal membrane 22 kDa family protein similar to SP|P42925 22 kDa peroxisomal membrane protein {Mus musculus}; contains Pfam profile PF04117: Mpv17 / PMP22 family Length = 288 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G G GGGG Sbjct: 78 GGNSGGSGGLGGSGGG---GGGSGGGG 101 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/60 (30%), Positives = 18/60 (30%) Frame = +2 Query: 260 PXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P PPPP P PPPP PPP P P P P P Sbjct: 14 PLPPPPP--PLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRP 71 >At4g18020.3 68417.m02683 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 487 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPP--XXPPXXXXXGXXXGXPGLPPNRG 496 PP P PPP PPP PP G G P PP G Sbjct: 401 PPGAIPPLWPPPLQSIGQPPPWHWKPPYPTVSGNAWGCPVGPPVTG 446 >At4g18020.2 68417.m02682 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPP--XXPPXXXXXGXXXGXPGLPPNRG 496 PP P PPP PPP PP G G P PP G Sbjct: 401 PPGAIPPLWPPPLQSIGQPPPWHWKPPYPTVSGNAWGCPVGPPVTG 446 >At4g18020.1 68417.m02681 pseudo-response regulator 2 (APRR2) (TOC2) identical to pseudo-response regulator 2 GI:7576356 from [Arabidopsis thaliana] Length = 535 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPP--XXPPXXXXXGXXXGXPGLPPNRG 496 PP P PPP PPP PP G G P PP G Sbjct: 401 PPGAIPPLWPPPLQSIGQPPPWHWKPPYPTVSGNAWGCPVGPPVTG 446 >At3g11402.1 68416.m01388 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 708 Score = 31.5 bits (68), Expect = 0.86 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP 382 P PP PPPP P PPPP P P Sbjct: 32 PPPPPPPPPPVLPHIRSRKKMDIKEVHLPLPRHYPPPPPPLPPP 75 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.5 bits (68), Expect = 0.86 Identities = 17/65 (26%), Positives = 18/65 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P P P P P +P PP Sbjct: 464 PTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPP 523 Query: 425 PXXPP 439 P PP Sbjct: 524 PVKPP 528 Score = 31.1 bits (67), Expect = 1.1 Identities = 24/94 (25%), Positives = 25/94 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P PP P P PP P PP Sbjct: 632 PTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPP-PVQLPP--TPTYSPP 688 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P PP +P PP Sbjct: 689 VKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPP 722 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/66 (27%), Positives = 19/66 (28%), Gaps = 1/66 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP-PPXPXPAXXPPPXAPXPXP 421 P PP PPP P PP P P P +P P Sbjct: 279 PIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKP 338 Query: 422 PPXXPP 439 PP PP Sbjct: 339 PPVKPP 344 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P PPP P P PP PP P PP P PP Sbjct: 444 PPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPP 502 Score = 30.7 bits (66), Expect = 1.5 Identities = 21/83 (25%), Positives = 21/83 (25%), Gaps = 2/83 (2%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX--APXPX 418 P PP PPP P PP P P P P Sbjct: 666 PTYSPPVKPPPVQLPPTPTYSPPVKPPPVQVPPTPTYSPPVKPPPVQVPPTPTYSPPIKP 725 Query: 419 PPPXXPPXXXXXGXXXGXPGLPP 487 PP PP G G PP Sbjct: 726 PPVQVPPTPTTPSPPQGGYGTPP 748 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P PPP P P PP PP P PP P PP Sbjct: 158 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 216 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPX-PPPXXPP 439 PPPP P PPP P PP PP Sbjct: 58 PPPPIYSPPIYPPPIQKPPTYSPPIYPP 85 Score = 29.9 bits (64), Expect = 2.6 Identities = 22/95 (23%), Positives = 25/95 (26%), Gaps = 1/95 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPP-PPXPXPAXXPPPXAPXPXP 421 P PP PPP P PP P P P +P P Sbjct: 346 PIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPIQKPPTPTYSPPIKP 405 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P + P I + PP Sbjct: 406 PPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPP 440 Score = 29.1 bits (62), Expect = 4.6 Identities = 24/94 (25%), Positives = 24/94 (25%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P PP P P PP P PP Sbjct: 194 PIYSPPIKPPPVHKPPTPIYSPPIKPPPVHKPPTPTYSPPVKPP-PVHKPP--TPIYSPP 250 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P PP P PP Sbjct: 251 IKPPPVHKPPTPIYSPPVKPPPVQTPPTPIYSPP 284 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/95 (23%), Positives = 25/95 (26%), Gaps = 1/95 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPX-APXPXP 421 P PP PPP P PP P P P +P P Sbjct: 262 PIYSPPVKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPPVKSPPVQKPPTPTYSPPIKP 321 Query: 422 PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P + P I + PP Sbjct: 322 PPVQKPPTPTYSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/81 (22%), Positives = 20/81 (24%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P P P P P +P PP Sbjct: 447 PIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPP 506 Query: 425 PXXPPXXXXXGXXXGXPGLPP 487 P P P + P Sbjct: 507 PIQKPPTPTYSPPIKPPPVKP 527 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGL-PPNRGIPXXLXRXPP 526 PP P P PPP P P PP PP P + PP +P PP Sbjct: 107 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPPPVQMPPTPTYSPP 166 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/96 (25%), Positives = 25/96 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P PP P P PP P PP Sbjct: 110 PTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPPTPSYSPPVKPP-PVQMPP--TPTYSPP 166 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PP P + P P Sbjct: 167 IKPPPVHKPPTPTYSPPIKPPVHKPPTPIYSPPIKP 202 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/60 (31%), Positives = 21/60 (35%), Gaps = 4/60 (6%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGL-PPNRGIPXXLXRXPP 526 PP P P PPP P P PP PP P + PP +P PP Sbjct: 629 PPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPP 688 Score = 28.7 bits (61), Expect = 6.0 Identities = 22/86 (25%), Positives = 23/86 (26%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P PP P P PP P PP Sbjct: 649 PTYSPPIKPPPVQKPPTPTYSPPVKPPPVQLPPTPTYSPPVKPP-PVQVPP--TPTYSPP 705 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIP 502 PP P PP +P Sbjct: 706 VKPPPVQVPPTPTYSPPIKPPPVQVP 731 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PP +P PPP P Sbjct: 65 PPIYPPPIQKPPTYSPPIYPPPIQKP 90 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPP 439 PP P P PPP P P PP PP Sbjct: 90 PPTPTYSPPIYPPPIQKPPTPTYSPPIYPP 119 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/63 (30%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGL--PPNRGIPXXLXRXP 523 PP P P PPP P P PP PP P + PP P + P Sbjct: 208 PPTPIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPPPVHKPPTPIYSPP 267 Query: 524 PXP 532 P Sbjct: 268 VKP 270 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/94 (25%), Positives = 24/94 (25%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PPP P PP P P PP P PP Sbjct: 211 PIYSPPIKPPPVHKPPTPTYSPPVKPPPVHKPPTPIYSPPIKPP-PVHKPP--TPIYSPP 267 Query: 425 PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P PP P PP Sbjct: 268 VKPPPVQTPPTPIYSPPVKPPPVHKPPTPTYSPP 301 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/59 (30%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP---PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P P PPP P P PP PP P + P P PP Sbjct: 427 PPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTPTYSPPIKPPPVKPPTPTYSPP 485 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 31.5 bits (68), Expect = 0.86 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGG--XGXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGG Sbjct: 128 GGSYGGGRREGGGGYGGGEGGGYGGSGGG 156 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/65 (30%), Positives = 21/65 (32%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GG G G GGG + GGG G Sbjct: 93 GGHRGGG-SYGGGGGRREGGGGYSGGGGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYG 151 Query: 258 GXGXG 244 G G G Sbjct: 152 GSGGG 156 Score = 29.1 bits (62), Expect = 4.6 Identities = 20/63 (31%), Positives = 20/63 (31%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GGG G GGG G GGG G G GG G Sbjct: 98 GGSYGGGGGRREGGGGYSGG---GGGYSSRGGGGGSYGGGRREGGGGYGGGEGGGYGGSG 154 Query: 258 GXG 250 G G Sbjct: 155 GGG 157 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 31.5 bits (68), Expect = 0.86 Identities = 18/63 (28%), Positives = 20/63 (31%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP P Sbjct: 111 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPP 170 Query: 419 PPP 427 PPP Sbjct: 171 PPP 173 Score = 29.5 bits (63), Expect = 3.5 Identities = 24/103 (23%), Positives = 30/103 (29%), Gaps = 9/103 (8%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 221 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 280 Query: 419 PPP-----XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP P + + P + + PP P Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPP 323 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 131 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPPYVYSSP 190 Query: 419 PPP 427 PPP Sbjct: 191 PPP 193 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 191 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 250 Query: 419 PPP 427 PPP Sbjct: 251 PPP 253 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 201 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 260 Query: 419 PPP 427 PPP Sbjct: 261 PPP 263 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 211 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 270 Query: 419 PPP 427 PPP Sbjct: 271 PPP 273 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 271 PPPPYVYKSPPPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSP 330 Query: 419 PPP 427 PPP Sbjct: 331 PPP 333 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 281 PPPPYVYSSPPPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSP 340 Query: 419 PPP 427 PPP Sbjct: 341 PPP 343 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 291 PPPPYVYSSPPPPPYVYSSPPPPPYVYKSPPPPPYVYTSPPPPPYVYKSPPPPPYVDSYS 350 Query: 419 PPP 427 PPP Sbjct: 351 PPP 353 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 31.1 bits (67), Expect = 1.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P PP P PPP PP Sbjct: 169 PSIPPPSPPYFPPEPPSIPPPPPPSPP 195 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G GA GGG G G GGG Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGG 56 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G GGGG Sbjct: 44 GGSYGGRGGYG--GGGGRGNRGGGGGG 68 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G GA GGG G G GGG Sbjct: 30 GGGDAGYGGRGASGGGSYGGRGGYGGG 56 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G GGG G GGGG Sbjct: 44 GGSYGGRGGYG--GGGGRGNRGGGGGG 68 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/27 (55%), Positives = 15/27 (55%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GA GGG G G GG Sbjct: 173 GGASGGGPG-GASGGGPGGASGGGPGG 198 Score = 30.7 bits (66), Expect = 1.5 Identities = 18/69 (26%), Positives = 18/69 (26%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXX 277 P GG GGG G GG G G G G Sbjct: 129 PSGDKPGGASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGGASGGGPGGASGGGP 188 Query: 276 GGGGXGGXG 250 GG GG G Sbjct: 189 GGASGGGPG 197 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 31.1 bits (67), Expect = 1.1 Identities = 25/99 (25%), Positives = 27/99 (27%), Gaps = 5/99 (5%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPP---PXPXPAXXPPPXA--PXP 415 P PP PP P PP P P P PPP P P Sbjct: 181 PCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPPPVPVYKPPPKVELPPP 240 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P PP P P P + + PP P Sbjct: 241 IPKKPCPPKPPKIEHPPPVPVYKP----PPKIEKPPPVP 275 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPP P P PP AP P PP P P +P Sbjct: 81 PPPTPVPESSPPVPAPMVSSPVSSPPVPAPVADSPPAPVAAPVADVP 127 >At3g20890.1 68416.m02641 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative similar to SP|P52597 Heterogeneous nuclear ribonucleoprotein F (hnRNP F) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 350 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG G GG Sbjct: 213 GGGLGGGNGSGGGGGGGGGGGRISGG 238 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G G G G GGGG Sbjct: 207 GMASGGGGGLGGGNGSGGGGGGGGGGG 233 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 31.1 bits (67), Expect = 1.1 Identities = 26/107 (24%), Positives = 30/107 (28%), Gaps = 5/107 (4%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXP-----AXXPPPXAPXP 415 P PP PPPP PPPP P P P + Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPPLHSNSRMGAPTSSLVL 660 Query: 416 XPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKT 556 PP PP +PP G P L + G G+T Sbjct: 661 KSPPVPPPPAPAPLSRSHNGNIPPVPGPPLGLKGRGILQNLKGQGQT 707 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +2 Query: 257 PPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PP PPPP P + PPPP P + P PPP P Sbjct: 571 PPPPPPPP--PISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLPP 628 Score = 30.3 bits (65), Expect = 2.0 Identities = 24/93 (25%), Positives = 30/93 (32%), Gaps = 14/93 (15%) Frame = +2 Query: 359 PPPPXPXPAXX----PPPXAPX-------PXPPPXXPPXXXXXGXXXGXP---GLPPNRG 496 PPPP P P P P + P PPP PP P LPP + Sbjct: 572 PPPPPPPPISSLRSTPSPSSTSNSIATQGPPPPPPPPPLQSHRSALSSSPLPPPLPPKKL 631 Query: 497 IPXXLXRXPPXP*IXGGGKTXPLLXXIFXKGPP 595 + PP P + + + K PP Sbjct: 632 LATTNPPPPPPPPLHSNSRMGAPTSSLVLKSPP 664 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/57 (33%), Positives = 22/57 (38%), Gaps = 2/57 (3%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPP--PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P P P P+ PPP PP P PP G P P+ +P L PP Sbjct: 27 PNPNPNPSLTPPPPQQHSQPPVAPLVPP-----GPPYAPPAQIPSSLLPTNLPPPPP 78 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 P P P PA P P AP P P P P P PPN+ Sbjct: 295 PTPAPAPAPAPAP-APAPSPAPASAPVPAPAPTPAPAPA-PPNK 336 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 362 PPPXPXPAXXP-PPXAPXPXPPPXXPPXXXXXGXXXG 469 P P P PA P P AP P P P P G G Sbjct: 309 PAPSPAPASAPVPAPAPTPAPAPAPPNKVEALGGNGG 345 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PA P P AP P P P P Sbjct: 291 PLPAPTPAPAPAP-APAPAPAPSPAP 315 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNR 493 P P P PA P P AP P P P P P PPN+ Sbjct: 295 PTPAPAPAPAPAP-APAPSPAPASAPVPAPAPTPAPAPA-PPNK 336 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +2 Query: 362 PPPXPXPAXXP-PPXAPXPXPPPXXPPXXXXXGXXXG 469 P P P PA P P AP P P P P G G Sbjct: 309 PAPSPAPASAPVPAPAPTPAPAPAPPNKVEALGGNGG 345 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P PA P P AP P P P P Sbjct: 291 PLPAPTPAPAPAP-APAPAPAPSPAP 315 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/26 (57%), Positives = 15/26 (57%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G GGG AG G GG Sbjct: 83 GGGIGGGFGGGGFGGG--AGKGVDGG 106 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G G G G Sbjct: 80 GGFGGGIGGGFGGGGFGGGAGKGVDG 105 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G GA GG G GGG Sbjct: 59 GGGISGGGGFGAGGGWIGGSVGGFGGG 85 >At1g19950.1 68414.m02500 abscisic acid-responsive HVA22 family protein weak similarity to SP|Q00765 Polyposis locus protein 1 (TB2 protein) {Homo sapiens}; contains Pfam profile PF03134: TB2/DP1, HVA22 family Length = 315 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 234 PPGPPPPPPPPP 245 Score = 25.4 bits (53), Expect(2) = 1.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 235 PGPPPPPPPPP 245 Score = 23.8 bits (49), Expect(2) = 1.5 Identities = 10/27 (37%), Positives = 10/27 (37%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P P A P P Sbjct: 237 PPPPPPPPPPSPTTAAKRNADPAQPSP 263 >At5g67060.1 68418.m08455 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain Length = 241 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG GGG A G GGGG Sbjct: 192 GGGGGGGGRVLIGGGGMTAASGGGGGG 218 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 30.7 bits (66), Expect = 1.5 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G G+ G G G G GGG Sbjct: 94 GGARGGGYGYGS-GNGRSGGGGGGGG 118 >At5g59270.1 68418.m07427 lectin protein kinase family protein contains Pfam domains PF00139: Legume lectins beta domain and PF00069: Protein kinase domain Length = 668 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PP P P+ PPP P P PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 30.3 bits (65), Expect = 2.0 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPP 427 PP P P PPP P P PP Sbjct: 262 PPNRPPPPSSPPPPPPPPPTPP 283 Score = 28.7 bits (61), Expect = 6.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 380 PAXXPPPXAPXPXPPPXXPP 439 P PPP +P P PPP P Sbjct: 263 PNRPPPPSSPPPPPPPPPTP 282 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P P P P PP Sbjct: 50 PPPPSPPPPSTPTTACPPPPSPP 72 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/54 (25%), Positives = 18/54 (33%) Frame = +3 Query: 405 PPXXPPPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF 566 P PPP PP SPP+ P + G + PPP+ Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPY 98 >At3g58510.2 68416.m06522 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GGG G GGG G G GG Sbjct: 573 GGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G G G G GGGG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGG 594 >At3g58510.1 68416.m06521 DEAD box RNA helicase, putative (RH11) similar to RNA helicase DBY protein [Mus musculus] GI:3790186, SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH11 GI:3775998 Length = 612 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGG 364 GG GGG G GGG G G GG Sbjct: 573 GGGGGGGGGSDYYGGGGYGGGGYGG 597 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G G G G GGGG Sbjct: 572 GGGGGGGGGGSDYYGGGGYGGGG 594 >At3g26400.1 68416.m03292 eukaryotic translation initiation factor 4B, putative/ eIF-4B, putative similar to eukaryotic initiation factor 4B [Arabidopsis thaliana] GI:6739518 Length = 532 Score = 30.7 bits (66), Expect = 1.5 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G G G G G G GGGG Sbjct: 190 GRYSGDGGGFGGGGSGFGGGGGGGGGG 216 >At1g45688.1 68414.m05202 expressed protein Length = 342 Score = 30.7 bits (66), Expect = 1.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P PP P P AP P P P PP Sbjct: 260 PAPPAPLPKPKKKKGAPVPIPDPPAPP 286 >At1g35617.1 68414.m04424 hypothetical protein Length = 121 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPP 427 PPP P P PP P P PP Sbjct: 21 PPPAPPPESSSPPTPPEPPDPP 42 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 30.7 bits (66), Expect = 1.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P P P PPP Sbjct: 243 PPPPPPPPIPVKQSATPPPPPPP 265 Score = 29.9 bits (64), Expect = 2.6 Identities = 17/61 (27%), Positives = 18/61 (29%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PP PPPP P PPPP A + P P Sbjct: 239 PDPTPP-PPPPPPIPVKQSATPPPPPPPKLKNNGPSPPPPPPLKKTAALSSSASKKPPPA 297 Query: 425 P 427 P Sbjct: 298 P 298 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPP 487 P PP P P P + P PPP PP G P PP Sbjct: 241 PTPPPPPPPPIPVKQSATPPPPP--PPKLKNNGPSPPPP--PP 279 >At1g23720.1 68414.m02994 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 895 Score = 30.7 bits (66), Expect = 1.5 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P+ P + PP P Sbjct: 709 PPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPPYYSPS---PKVEYKSPPPP 763 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + + PP P Sbjct: 232 PPPPYVYSSPPPPYYSPSPKPAYKSPPPP----YVYSSPPPPYYSPSPKPIYKSPPPP 285 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + + PP P Sbjct: 482 PPPPYVYSSPPPPYYSPSPKPSYKSPPPP----YVYNSPPPPYYSPSPKVIYKSPPHP 535 Score = 29.1 bits (62), Expect = 4.6 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + + PP P Sbjct: 357 PPPPYVYSSPPPPYYSPSPKPTYKSPPPP----YVYSSPPPPYYSPSPKPVYKSPPPP 410 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 82 PPPPYVYSSPPPPYYSPSPKVDYKSPPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYNSP 141 Query: 419 PPPXXPP 439 PPP P Sbjct: 142 PPPYYSP 148 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 182 PPPPYVYNSPPPPYYSPSPKPTYKSPPPPYIYSSPPPPYYSPSPKPVYKSPPPPYVYSSP 241 Query: 419 PPPXXPP 439 PPP P Sbjct: 242 PPPYYSP 248 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + + PP P Sbjct: 182 PPPPYVYNSPPPPYYSPSPKPTYKSPPPP----YIYSSPPPPYYSPSPKPVYKSPPPP 235 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 232 PPPPYVYSSPPPPYYSPSPKPAYKSPPPPYVYSSPPPPYYSPSPKPIYKSPPPPYVYNSP 291 Query: 419 PPPXXPP 439 PPP P Sbjct: 292 PPPYYSP 298 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 282 PPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSP 341 Query: 419 PPPXXPP 439 PPP P Sbjct: 342 PPPYYSP 348 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/58 (29%), Positives = 21/58 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + + PP P Sbjct: 282 PPPPYVYNSPPPPYYSPSPKPAYKSPPPP----YVYSFPPPPYYSPSPKPVYKSPPPP 335 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 307 PPPPYVYSFPPPPYYSPSPKPVYKSPPPPYVYNSPPPPYYSPSPKPAYKSPPPPYVYSSP 366 Query: 419 PPPXXPP 439 PPP P Sbjct: 367 PPPYYSP 373 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 382 PPPPYVYSSPPPPYYSPSPKPVYKSPPPPYIYNSPPPPYYSPSPKPSYKSPPPPYVYSSP 441 Query: 419 PPPXXPP 439 PPP P Sbjct: 442 PPPYYSP 448 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 609 PPPPYVYNSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPTPKPTYKSPPPPYVYSSP 668 Query: 419 PPPXXPP 439 PPP P Sbjct: 669 PPPYYSP 675 Score = 28.7 bits (61), Expect = 6.0 Identities = 18/67 (26%), Positives = 18/67 (26%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P P PPP Sbjct: 659 PPPPYVYSSPPPPYYSPSPKPTYKSPPPPYVYSSPPPPYYSPAPKPTYKSPPPPYVYSSP 718 Query: 419 PPPXXPP 439 PPP P Sbjct: 719 PPPYYSP 725 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + PP P Sbjct: 659 PPPPYVYSSPPPPYYSPSPKPTYKSPPPP----YVYSSPPPPYYSPAPKPTYKSPPPP 712 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/58 (29%), Positives = 20/58 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPPP + PP +P P P PP P P P + PP P Sbjct: 609 PPPPYVYNSPPPPYYSPSPKPTYKSPPPP----YVYSSPPPPYYSPTPKPTYKSPPPP 662 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 30.3 bits (65), Expect = 2.0 Identities = 18/65 (27%), Positives = 18/65 (27%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PP P PP P PP AP P P Sbjct: 146 PVQSPPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKPPTAP-PVKP 204 Query: 425 PXXPP 439 P PP Sbjct: 205 PTPPP 209 >At5g10550.1 68418.m01221 DNA-binding bromodomain-containing protein low similarity to kinase [Gallus gallus] GI:1370092; contains Pfam profile PF00439: Bromodomain Length = 678 Score = 30.3 bits (65), Expect = 2.0 Identities = 13/28 (46%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXPXPAXXP-PPXAPXPXPPPXXPP 439 PPPP P PP +P PPP PP Sbjct: 410 PPPPVIEITRDPSPPPSPVQPPPPPSPP 437 Score = 29.5 bits (63), Expect = 3.5 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXP 421 P P P P PPP +P P P Sbjct: 421 PSPPPSPVQPPPPPSPPPQP 440 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPP PPP PPP G PG+PP+ Sbjct: 210 PPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPPH 253 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PPP PPP PPP P G PG+PP G Sbjct: 199 PPPQYGQRPMIPPPGGMMRGPPP---PPHGMQGPPPPRPGMPPAPG 241 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PP P P PP G G P P + R PP P Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPP 222 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 30.3 bits (65), Expect = 2.0 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPN 490 PPP PPP PPP G PG+PP+ Sbjct: 210 PPPGGMMRGPPPPPHGMQGPPPPRPGMPPAPGGFAPPRPGMPPH 253 Score = 29.9 bits (64), Expect = 2.6 Identities = 16/46 (34%), Positives = 17/46 (36%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRG 496 PPP PPP PPP P G PG+PP G Sbjct: 199 PPPQYGQRPMIPPPGGMMRGPPP---PPHGMQGPPPPRPGMPPAPG 241 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/56 (30%), Positives = 18/56 (32%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PP P PP P P PP G G P P + R PP P Sbjct: 167 PPPPFGGQGPPMGRGPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPP 222 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P P P PP Sbjct: 51 PPVMSPMPMMTPPPMPMTPPPMPMTPP 77 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 30.3 bits (65), Expect = 2.0 Identities = 17/57 (29%), Positives = 17/57 (29%), Gaps = 2/57 (3%) Frame = +2 Query: 362 PPPXPXPAXXPP--PXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 PP P PP P P P P PP PP G P PP Sbjct: 131 PPSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTPP 187 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 30.3 bits (65), Expect = 2.0 Identities = 25/81 (30%), Positives = 28/81 (34%), Gaps = 2/81 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXL-XRXPPXP* 535 PPPP P P P PPP P P P+ P L R PP P Sbjct: 42 PPPPQ---VFVPEPLFSEPPPPPKAP---VNVSLSPPPPPRSPSTSTPPRLGNRNPPPPA 95 Query: 536 IXGGGK-TXPLLXXIFXKGPP 595 G + T P + F PP Sbjct: 96 SPSGQEPTTPTMTPGFSLSPP 116 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/81 (27%), Positives = 26/81 (32%), Gaps = 1/81 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 PPPP P+ PP PPP P PG + P L Sbjct: 71 PPPPPRSPSTSTPPRLGNRNPPPPASPSGQEPTTPTMTPGFSLSPPSPSRLSTGAVVGIS 130 Query: 539 XGGGK-TXPLLXXIFXKGPPR 598 GGG L+ + K PR Sbjct: 131 IGGGVFVLTLIFFLCKKKRPR 151 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 30.3 bits (65), Expect = 2.0 Identities = 23/72 (31%), Positives = 24/72 (33%), Gaps = 4/72 (5%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXG----XXXGXPGLPPNRGIPXXLXRXPP 526 PPPP + PPP PPP P G G P PP G P P Sbjct: 252 PPPPHIGGSAPPPPHMGGSAPPP--PHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGP 309 Query: 527 XP*IXGGGKTXP 562 P GG P Sbjct: 310 RPPQNYGGTPPP 321 >At3g03920.1 68416.m00407 Gar1 RNA-binding region family protein contains Pfam profile PF04410: Gar1 protein RNA binding region Length = 202 Score = 30.3 bits (65), Expect = 2.0 Identities = 15/29 (51%), Positives = 15/29 (51%), Gaps = 2/29 (6%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXG--XGGGG 358 GG GGG G GGG G G GGGG Sbjct: 15 GGRDGGGGGRFGGGGGRFGGGGGRFGGGG 43 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GG Sbjct: 22 GGRFGGGGGRFGGGGGRFGGGGGRFGG 48 >At2g45420.1 68415.m05650 LOB domain protein 18 / lateral organ boundaries domain protein 18 (LBD18) identical to LOB DOMAIN 18 [Arabidopsis thaliana] GI:17227164; supported by full-length cDNA gi:17227163 Length = 262 Score = 30.3 bits (65), Expect = 2.0 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -3 Query: 423 GGXGXGAXGGGXXAGXGXGGGG 358 GG G G GGG G G GGG Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGG 33 Score = 29.9 bits (64), Expect = 2.6 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G GG + G GGG Sbjct: 12 GGGGGGCGGGGSSGGGGSSGGGGGG 36 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G+ GGG + G GGGG Sbjct: 12 GGGGGGCGGGGSSGGGGSS--GGGGGG 36 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 30.3 bits (65), Expect = 2.0 Identities = 19/64 (29%), Positives = 19/64 (29%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G GGG G G G G G GG GG Sbjct: 24 GGGGGGPAFGGRGGGPGRGYGGGPRVHGPGYGIGSRGPDPGPGFFFGGAGPGPGYGGGGG 83 Query: 255 XGXG 244 G G Sbjct: 84 HGPG 87 >At5g39760.1 68418.m04816 zinc finger homeobox protein-related / ZF-HD homeobox protein-related predicted proteins, Arabidopsis thaliana Length = 334 Score = 25.8 bits (54), Expect(2) = 2.5 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXP 415 PPPP P P P +P P Sbjct: 136 PPPPPPPPPRSPNSASPPP 154 Score = 22.6 bits (46), Expect(2) = 2.5 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 245 PXPXPPXPPP 274 P P PP PPP Sbjct: 135 PPPPPPPPPP 144 >At5g57290.1 68418.m07157 60S acidic ribosomal protein P3 (RPP3B) Length = 120 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGG 364 GGG G A GGG AG G GG Sbjct: 71 GGGGGGFAAGGGAAAGGGGGG 91 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 29.9 bits (64), Expect = 2.6 Identities = 18/50 (36%), Positives = 18/50 (36%), Gaps = 4/50 (8%) Frame = +2 Query: 359 PPPPXPXPAXXPP---PXAPXPXPPPXXPPXXXXXGXXXGXP-GLPPNRG 496 PP P P PP P P PP PP G P G PP G Sbjct: 17 PPAGYPPPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAPG 66 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 1/47 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP-PXXXXXGXXXGXPGLPPNRG 496 PPPP P PP A P P P P G G PP G Sbjct: 38 PPPPGAYPPAGYPPGAYPPAPGGYPPAPGYGGYPPAPGYGGYPPAPG 84 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 3/29 (10%) Frame = +2 Query: 362 PPPXPXPAXXPP---PXAPXPXPPPXXPP 439 P P P P PP P P P P P PP Sbjct: 40 PSPKPKPVQCPPPPRPSVPSPNPRPVTPP 68 >At2g11005.1 68415.m01177 glycine-rich protein Length = 170 Score = 29.9 bits (64), Expect = 2.6 Identities = 14/27 (51%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = -3 Query: 438 GGXXGGGXGXG-AXGGGXXAGXGXGGG 361 GG GGG G G G G G G GGG Sbjct: 15 GGGSGGGGGSGDGSGSGDGGGSGDGGG 41 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 G GGG G G G G +G G GGG Sbjct: 11 GSGDGGGSGGGG-GSGDGSGSGDGGG 35 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 29.9 bits (64), Expect = 2.6 Identities = 15/30 (50%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Frame = -3 Query: 438 GGXXGGGX---GXGAXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGG Sbjct: 49 GGYNGGGGYNGGGGHNGGGYNGGGGYNGGG 78 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G G GGG Sbjct: 46 GGNGGYNGGGGYNGGGGHNGGGYNGGG 72 >At1g27880.1 68414.m03416 ATP-dependent DNA helicase, putative similar to SP|O94761 ATP-dependent DNA helicase Q4 (RecQ4) {Homo sapiens}; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 911 Score = 29.9 bits (64), Expect = 2.6 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 P P P P+ P +P P PPP P Sbjct: 54 PTHPPPNPSQEAPVPSPYPPPPPPSP 79 >At1g11850.1 68414.m01363 expressed protein Length = 93 Score = 29.9 bits (64), Expect = 2.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 G G G G G GGG G G G GG Sbjct: 65 GAGIGAGAGLGLGGGGFGGGAGGGLGG 91 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG G G G G GG G G G G Sbjct: 42 GGGSGDGLGLGLGGGAGLGGLGIGAG 67 >At5g60850.1 68418.m07633 Dof-type zinc finger domain-containing protein similar to zinc finger protein OBP4 gi:5059396 from [Arabidopsis thaliana]; EMBL:AF155817 Length = 307 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -3 Query: 420 GXGXGAXGGGXXAGXGXGGGG 358 G G G GGG G G GGGG Sbjct: 11 GVGGGGGGGGRFFGGGIGGGG 31 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/57 (31%), Positives = 21/57 (36%), Gaps = 2/57 (3%) Frame = +2 Query: 368 PXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXG--XPGLPPNRGIPXXLXRXPPXP 532 P + PPP P P PPP PP G G+ N+ I PP P Sbjct: 373 PPQYQSLIPPPSPP-PPPPPPPPPLRSSQSVFYGLFKKGVKSNKKIHSVPAPPPPPP 428 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXP 436 PP PA PPP P P P P Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKP 267 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 248 PPATPPPPPPPP 259 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 296 PPPSPPPPPPPP 307 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 297 PPSPPPPPPPPP 308 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 381 PPPSPPPPPPPP 392 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 382 PPSPPPPPPPPP 393 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 29.5 bits (63), Expect = 3.5 Identities = 17/61 (27%), Positives = 17/61 (27%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGX 247 GGG G G G G G GG G G GG G G Sbjct: 5 GGGSGSSGSGSGGSVSGGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGR 64 Query: 246 G 244 G Sbjct: 65 G 65 Score = 29.5 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GG G G G G G G GG Sbjct: 16 GGSVSGGSGSGGSGSGGSGSGGSGSGG 42 Score = 28.3 bits (60), Expect = 8.0 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXA-GXGXGGGG 358 GG GG G G G G A G G GG G Sbjct: 26 GGSGSGGSGSGGSGSGGRANGRGNGGRG 53 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GGG G GA G G G G G G Sbjct: 75 GGGLGGGLGGGA-GSGLGGGLGGGSG 99 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/26 (53%), Positives = 15/26 (57%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG +G G G GG Sbjct: 72 GGAGGGLG-GGLGGGAGSGLGGGLGG 96 >At4g29020.1 68417.m04149 glycine-rich protein supporting cDNA gi|20465684|gb|AY096677.1| Length = 158 Score = 29.5 bits (63), Expect = 3.5 Identities = 19/62 (30%), Positives = 19/62 (30%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G G G G GGG G G GG GG Sbjct: 79 GGVGGGIGGLGGGVGGLGGLGGLGGGSGLGHGVGGIGGDPGIGSGIGGLGGAGGLGGIGG 138 Query: 255 XG 250 G Sbjct: 139 VG 140 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/63 (28%), Positives = 19/63 (30%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*I 538 P P P PPP P PP P PG+ P G P P Sbjct: 100 PRPMMPPQGYMPPPGVPQMMAPPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQ 159 Query: 539 XGG 547 GG Sbjct: 160 GGG 162 >At3g01650.1 68416.m00096 copine-related low similarity to SP|Q99829 Copine I {Homo sapiens} Length = 489 Score = 29.5 bits (63), Expect = 3.5 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP PA P P AP P P P Sbjct: 35 PPPPTYAPAPSPAP-APAPVPAP 56 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P P P P P P Sbjct: 146 PPPPPPQPESPSSPSYPEPAPVP 168 Score = 26.2 bits (55), Expect(2) = 4.3 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P P P P P Sbjct: 148 PPPPQPESPSSPSYPEPAPVPAP 170 Score = 21.4 bits (43), Expect(2) = 4.3 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPP P Sbjct: 144 PSPPPPPPQPESP 156 >At1g70140.1 68414.m08071 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 760 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 P PP P P+ AP P PPP Sbjct: 236 PTPPPPPPSIAVKQSAPTPSPPP 258 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/81 (24%), Positives = 20/81 (24%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PP PP P PP P PPP P P Sbjct: 131 PIQPPPVTTPPGLLPPITTPPGLLPPVTTPPGLLPPVTTPPGLLPPIINPPPVT-VPPPS 189 Query: 425 PXXPPXXXXXGXXXGXPGLPP 487 PP G G G P Sbjct: 190 SGYPPYGPPSGGGGGGGGKQP 210 >At1g48280.1 68414.m05393 hydroxyproline-rich glycoprotein family protein Length = 558 Score = 29.5 bits (63), Expect = 3.5 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 408 PXXPPPPXPPPXXXXXXRXXAXXXSPPTGE 497 P PPPP PPP + SPP + Sbjct: 258 PPTPPPPPPPPPPRPLAKAARAQKSPPVSQ 287 Score = 25.4 bits (53), Expect(2) = 6.7 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 259 PTPPPPPPPPP 269 Score = 21.4 bits (43), Expect(2) = 6.7 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P A PP Sbjct: 262 PPPPPPPPPRPLAKAARAQKSPP 284 >At1g28290.1 68414.m03472 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 359 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/85 (25%), Positives = 22/85 (25%), Gaps = 4/85 (4%) Frame = +2 Query: 245 PXPXPPXPP--PPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPP--PXAPX 412 P P PP PP P P P P PP P A Sbjct: 131 PVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKP 190 Query: 413 PXPPPXXPPXXXXXGXXXGXPGLPP 487 P PP PP P PP Sbjct: 191 PVKPPVYPPTKAPVKPPVSPPTKPP 215 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 2/58 (3%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP--PPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPP 526 P P P PP AP P PP PP P PP + P PP Sbjct: 83 PAKPPVKPPVYPPTKAPVKPPTKPPVKPPVSPPAKPPVKPPVYPPTKA-PVKPPTKPP 139 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 29.5 bits (63), Expect = 3.5 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GGG Sbjct: 40 GGEGGGGEGTSGEGGG-GGGDGTKGGG 65 Score = 29.5 bits (63), Expect = 3.5 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGG 256 G GGG G G GGG G G G G GGG G Sbjct: 51 GEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRGGW 110 Query: 255 XG 250 G Sbjct: 111 NG 112 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G G GGG Sbjct: 57 GGDGTKGGGDGISGGGHGDGLGCSGGG 83 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 29.5 bits (63), Expect = 3.5 Identities = 20/66 (30%), Positives = 20/66 (30%), Gaps = 1/66 (1%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 GG GG G G GG G G GGG G GG G Sbjct: 133 GGGVGGLGGVGGLGGAGLGGVGGVGGGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIG 192 Query: 258 -GXGXG 244 G G G Sbjct: 193 VGGGIG 198 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 29.1 bits (62), Expect = 4.6 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 3/26 (11%) Frame = +2 Query: 359 PPPPXPXPAXX---PPPXAPXPXPPP 427 P PP P PA PPP P PPP Sbjct: 539 PRPPLPPPARARPLPPPARARPMPPP 564 Score = 26.2 bits (55), Expect(2) = 3.9 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 P PP PPP P PPP Sbjct: 551 PLPPPARARPMPPPARARPLPPP 573 Score = 21.4 bits (43), Expect(2) = 3.9 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P PP PPP P Sbjct: 539 PRPPLPPPARARP 551 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 24.2 bits (50), Expect(2) = 3.9 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 359 PPPPXPXPAXXPPP 400 PPPP P P PP Sbjct: 27 PPPPLPLPPSPSPP 40 Score = 23.4 bits (48), Expect(2) = 3.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 245 PXPXPPXPPPPXXXP 289 P PP PPPP P Sbjct: 20 PKNRPPSPPPPLPLP 34 >At3g47930.1 68416.m05226 L-galactono-1,4-lactone dehydrogenase, putative strong similarity to L-galactono-1,4-lactone dehydrogenase, Brassica oleracea, Z97060 [gi:2760543], and gi:3986289 from Ipomea batatas Length = 610 Score = 25.4 bits (53), Expect(2) = 4.0 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 45 PPPPPPRPPPP 55 Score = 22.2 bits (45), Expect(2) = 4.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 392 PPPXAPXPXPP 424 PPP P P PP Sbjct: 47 PPPPRPPPPPP 57 >At1g72790.1 68414.m08415 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 561 Score = 25.0 bits (52), Expect(2) = 4.0 Identities = 16/64 (25%), Positives = 16/64 (25%), Gaps = 2/64 (3%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPX--PAXXPPPXAPXPXPP 424 P PP PPPP PP P P P PP Sbjct: 394 PPPPPPPPPPERRYESRASTSKLRKAPVESRTSKPNPPAKVTQYVGTGSESPLMPIPPPP 453 Query: 425 PXXP 436 P P Sbjct: 454 PPPP 457 Score = 22.6 bits (46), Expect(2) = 4.0 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +2 Query: 245 PXPXPPXPPP 274 P P PP PPP Sbjct: 365 PPPPPPPPPP 374 >At4g12500.1 68417.m01975 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 177 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P+ P P P P P P PP Sbjct: 60 PTPSVPTPSV-PTPSVPSPNPTPVTPP 85 >At4g12490.1 68417.m01974 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 182 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P+ P P P P P P PP Sbjct: 65 PSPSVPTPSV-PSPSVPSPNPTPVIPP 90 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 29.1 bits (62), Expect = 4.6 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 P P P P+ P P P P P P PP Sbjct: 52 PKPVPSPSV-PSPSVPSPNPRPVTPP 76 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P PPPP P + PPPP P P P AP P PP Sbjct: 292 PKEDVPPPP---PLTSPQTPSPTVSTFNTKSSLRSQPPPPPPSPEHKAP--APPPPPP 344 >At3g50650.1 68416.m05540 scarecrow-like transcription factor 7 (SCL7) Length = 542 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P +P PPP P Sbjct: 143 PPPPASTAIWSPSPPSPQHPPPPPPQP 169 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 29.1 bits (62), Expect = 4.6 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 1/44 (2%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXP-PPXXPPXXXXXGXXXGXPGLPP 487 PPPP P P P A P PP PP P PP Sbjct: 12 PPPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPPP 55 Score = 28.3 bits (60), Expect = 8.0 Identities = 16/66 (24%), Positives = 21/66 (31%) Frame = +2 Query: 407 PXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGGKTXPLLXXIFXK 586 P P PPP P P LPP + + PP P + + + K Sbjct: 13 PPPPPPPLLQPHHSALSSSPLPPPLPPKKLLATTNTPPPPPPPLHSNSQMGAPTSSLVLK 72 Query: 587 GPPRXK 604 P K Sbjct: 73 SPHNLK 78 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 29.1 bits (62), Expect = 4.6 Identities = 18/63 (28%), Positives = 18/63 (28%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXG 259 G GG G A GGG G GGG G GGGG Sbjct: 251 GPAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGGP 310 Query: 258 GXG 250 G Sbjct: 311 NAG 313 >At3g04640.1 68416.m00497 glycine-rich protein predicted proteins, Arabidopsis thaliana Length = 159 Score = 29.1 bits (62), Expect = 4.6 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G G GGG G GGGG Sbjct: 73 GGGGGGRGGGGFGGG---GRSFGGGG 95 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G G G GGGG Sbjct: 77 GGRGGGGFGGGGRSFGGGGSSSRGGGG 103 >At3g02670.1 68416.m00258 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 217 Score = 29.1 bits (62), Expect = 4.6 Identities = 22/65 (33%), Positives = 22/65 (33%), Gaps = 1/65 (1%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXP-PXP* 535 P P P P P P P P G PGLP G P R P P P Sbjct: 82 PSSPGGNPGIPGSPGFRLPFPFPSSPGGNPGIPGIPGIPGLPGIPGSPG--FRLPFPFPS 139 Query: 536 IXGGG 550 GGG Sbjct: 140 SPGGG 144 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP PA PP + P P P Sbjct: 117 PPPPASSPAPPSPPSSSRPRPLP 139 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 29.1 bits (62), Expect = 4.6 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P P P P PPP Sbjct: 222 PPPPPPPSQPLPRPLLLPPPPPP 244 Score = 25.8 bits (54), Expect(2) = 5.4 Identities = 12/28 (42%), Positives = 12/28 (42%), Gaps = 2/28 (7%) Frame = +2 Query: 359 PPP--PXPXPAXXPPPXAPXPXPPPXXP 436 PPP P P P PPP P P P Sbjct: 226 PPPSQPLPRPLLLPPPPPPSFHAQPILP 253 Score = 21.4 bits (43), Expect(2) = 5.4 Identities = 7/13 (53%), Positives = 7/13 (53%) Frame = +2 Query: 251 PXPPXPPPPXXXP 289 P P PPPP P Sbjct: 219 PLQPPPPPPPSQP 231 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 29.1 bits (62), Expect = 4.6 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +2 Query: 395 PPXAPXPXPPPXXPP 439 PP AP P PPP PP Sbjct: 23 PPSAPLPPPPPLPPP 37 Score = 25.8 bits (54), Expect(2) = 4.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PPPP P P PPP P P Sbjct: 30 PPPPLPPP---PPPRQSHPESP 48 Score = 21.4 bits (43), Expect(2) = 4.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPP Sbjct: 27 PLPPPPPLPPP 37 >At1g15130.1 68414.m01807 hydroxyproline-rich glycoprotein family protein Length = 846 Score = 29.1 bits (62), Expect = 4.6 Identities = 26/104 (25%), Positives = 26/104 (25%), Gaps = 2/104 (1%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPP P PP P P P AP P PP Sbjct: 742 PTASSPPPPPETQNPSHPHPHAPYYRPPEQMSRPGYSIPPYGPPPPYHTPHGQAPQPYPP 801 Query: 425 --PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IXGGG 550 P G G P P PP GGG Sbjct: 802 QAQQQPHPSWQQGSYYDPQGQQPRPPYPGQSPYQPPH---QGGG 842 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 29.1 bits (62), Expect = 4.6 Identities = 25/88 (28%), Positives = 25/88 (28%), Gaps = 11/88 (12%) Frame = +2 Query: 257 PPXPPPPXXX-----PXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXP 421 PP PPPP P A PPPP P P A P P Sbjct: 194 PPPPPPPGNAAIPVEPPLTMSAEKESYAPLPPPPGRAALPPPP-PLPMAVRKGVAAPPLP 252 Query: 422 P------PXXPPXXXXXGXXXGXPGLPP 487 P P PP G P PP Sbjct: 253 PPGTAALPPPPPLPMAAGKGVAAPPPPP 280 >At4g03390.1 68417.m00461 leucine-rich repeat transmembrane protein kinase, putative similar to Z. mays leucine-rich repeat transmembrane protein kinase LRRTPK 1, GenBank accession number AF023164 Length = 776 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 427 PPPPPPPPPPPP 438 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 428 PPPPPPPPPPPP 439 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 429 PPPPPPPPPPPP 440 Score = 25.4 bits (53), Expect(2) = 5.1 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P PP PPPP Sbjct: 429 PPPPPPPPPPP 439 Score = 21.8 bits (44), Expect(2) = 5.1 Identities = 9/26 (34%), Positives = 9/26 (34%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP P P P P P Sbjct: 431 PPPPPPPPPPLDEKVTVMPIISPERP 456 >At5g52470.1 68418.m06510 fibrillarin 1 (FBR1) (FIB1) (SKIP7) identical to fibrillarin 1 GI:9965653 from [Arabidopsis thaliana]; C-terminus identical to SKP1 interacting partner 7 GI:10716959 from [Arabidopsis thaliana]; contains Pfam domain PF01269: Fibrillarin Length = 308 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG GGG G GGG G G GG Sbjct: 7 GGRGGGGFRGGRDGGGRGFGGGRSFGG 33 >At5g19090.2 68418.m02270 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 465 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 8/35 (22%) Frame = -3 Query: 438 GGXXGGGXGXG--------AXGGGXXAGXGXGGGG 358 GG GGG G G GGG G G GGGG Sbjct: 102 GGKGGGGGGGGPANNNKGQKIGGGGGGGGGGGGGG 136 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G GGG G G GGGG Sbjct: 111 GGPANNNKGQKIGGGGGGGGGGGGGGG 137 >At4g25630.1 68417.m03691 fibrillarin 2 (FIB2) identical to fibrillarin 2 GI:9965655 from [Arabidopsis thaliana] Length = 320 Score = 28.7 bits (61), Expect = 6.0 Identities = 20/70 (28%), Positives = 20/70 (28%), Gaps = 1/70 (1%) Frame = -3 Query: 456 PXXXXXGGXXGGGXGXGAXGGGXXAGXGXGG-GGXXXXXXXXXXXAXXXXXXXXXXXGXX 280 P GG GG G G GG G GG GG G Sbjct: 3 PPLTGSGGGFSGGRGRGGYSGGRGDGGFSGGRGGGGRGGGRGFSDRGGRGRGRGPPRGGA 62 Query: 279 XGGGGXGGXG 250 GG G G G Sbjct: 63 RGGRGPAGRG 72 >At4g15460.1 68417.m02363 glycine-rich protein Length = 148 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGG 361 GG GG G GGG G G G G Sbjct: 76 GGHASGGGGHAVEGGGHAGGGGGGHG 101 >At4g14750.1 68417.m02270 calmodulin-binding family protein contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 387 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/29 (44%), Positives = 13/29 (44%), Gaps = 2/29 (6%) Frame = +2 Query: 359 PPPPXPXPAXX--PPPXAPXPXPPPXXPP 439 PPPP PPP P P PPP P Sbjct: 54 PPPPACAITLKDSPPPPPPPPPPPPLQQP 82 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 67 PPPPPPPPPPPP 78 >At3g58020.1 68416.m06466 DNAJ heat shock N-terminal domain-containing protein contains Pfam profile PF00226 DnaJ domain Length = 580 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GG G G GGGG Sbjct: 24 GGGGGGHGGGGHGRGGHGRGGGG 46 >At3g22310.1 68416.m02818 DEAD box RNA helicase, putative (RH9) similar to RNA helicases GI:3775995, GI:3775987 [Arabidopsis thaliana]; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 610 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = -3 Query: 414 GXGAXGGGXXAGXGXGGGGXXXXXXXXXXXAXXXXXXXXXXXGXXXGGGGXGGXGXG 244 G GA GG G GGGG G GGGG G G Sbjct: 501 GVGARSGGSFGGGRSGGGGYGSYGSSSGRSGGGSYGGYGGSSGRSGGGGGSYGGSGG 557 >At3g08640.1 68416.m01003 alphavirus core protein family contains Pfam profile: PF00944 alphavirus core protein Length = 337 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GGG +G G GG G Sbjct: 63 GGGGSTGNNGGGSGSGGGGGGFG 85 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G +G G GGGG Sbjct: 61 GGGGGGSTGNNGGGSGSGGGGGG 83 >At3g08630.1 68416.m01002 expressed protein Length = 339 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G GGG +G G GG G Sbjct: 63 GGGGSIGNHGGGSGSGGGGGGYG 85 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/61 (27%), Positives = 20/61 (32%), Gaps = 4/61 (6%) Frame = +2 Query: 362 PPPXPXPAXXPP----PXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPX 529 PP P+ PP P +P P PP P P P+ P L P Sbjct: 49 PPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPP 108 Query: 530 P 532 P Sbjct: 109 P 109 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/63 (26%), Positives = 19/63 (30%) Frame = +2 Query: 251 PXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPX 430 P P PPPP P + PP PPP + P PP Sbjct: 65 PSSPPPPPPSSSPLSSLSP-----SLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPP 119 Query: 431 XPP 439 PP Sbjct: 120 PPP 122 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/57 (26%), Positives = 15/57 (26%) Frame = +2 Query: 266 PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPPPXXP 436 PPPP PPPP P P P PPP P Sbjct: 847 PPPPLGHSLPSVLQPPLQPQSQPPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSP 903 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P P PPP P P P P Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHP 893 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/103 (23%), Positives = 30/103 (29%), Gaps = 9/103 (8%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 71 PPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYIYKSPPPPPYVYSSPPPPPYVYKSP 130 Query: 419 PPP-----XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP P + + P + + PP P Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 173 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/103 (23%), Positives = 30/103 (29%), Gaps = 9/103 (8%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 131 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 190 Query: 419 PPP-----XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP P + + P + + PP P Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 233 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/103 (23%), Positives = 30/103 (29%), Gaps = 9/103 (8%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 191 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSP 250 Query: 419 PPP-----XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP P + + P + + PP P Sbjct: 251 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 293 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/103 (23%), Positives = 29/103 (28%), Gaps = 9/103 (8%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 241 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 300 Query: 419 PPP-----XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP P + + P + PP P Sbjct: 301 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYNSPPPP 343 Score = 28.7 bits (61), Expect = 6.0 Identities = 24/103 (23%), Positives = 30/103 (29%), Gaps = 9/103 (8%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 331 PPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPSPYVYKSPPPPPYVYSSPPPPPYVYKSP 390 Query: 419 PPP-----XXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP PP P + + P + + PP P Sbjct: 391 PPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPP 433 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 121 PPPPYVYKSPPPPPYVYNSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 180 Query: 419 PPP 427 PPP Sbjct: 181 PPP 183 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 181 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 240 Query: 419 PPP 427 PPP Sbjct: 241 PPP 243 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 381 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSP 440 Query: 419 PPP 427 PPP Sbjct: 441 PPP 443 Score = 28.3 bits (60), Expect = 8.0 Identities = 17/63 (26%), Positives = 19/63 (30%), Gaps = 4/63 (6%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP + PPPP + PPP Sbjct: 401 PPPPYVYKSPPPPPYVYSSPPPPPYVYKSPPPPPYVYSSPPPPPYVYKSPSPPPYVYKSP 460 Query: 419 PPP 427 PPP Sbjct: 461 PPP 463 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 28.7 bits (61), Expect = 6.0 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPX--PXPPPXXPPXXXXXGXXXGXPGLPPNRGIP 502 PPP P PP P P P P PP G P++G P Sbjct: 177 PPPIQPSGPATSPPANPNAPPSPFPTVPPKTPSSGPVVSPSLTSPSKGTP 226 >At1g22420.1 68414.m02803 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 480 Score = 28.7 bits (61), Expect = 6.0 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXP 436 PP P PA PP P PP P Sbjct: 164 PPPPVPANITPPPVPANITPPPVP 187 >At1g12810.1 68414.m01488 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 129 Score = 28.7 bits (61), Expect = 6.0 Identities = 17/49 (34%), Positives = 18/49 (36%), Gaps = 3/49 (6%) Frame = +2 Query: 365 PPXPXPAXXPPPXAPXPXPPPXXP-PXXXXXGXXXGXP--GLPPNRGIP 502 PP + PPP P PPP P P G P G PP P Sbjct: 12 PPPGYQSHYPPPGYPSAPPPPGYPSPPSHHEGYPPPQPYGGYPPPSSRP 60 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 28.7 bits (61), Expect = 6.0 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -3 Query: 426 GGGXGXGAXGGGXXAGXGXGGGG 358 GGG G G GGG +G GGG Sbjct: 66 GGGGGGGRGGGGARSGGRSRGGG 88 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPP 427 PPPP P+ PP PPP Sbjct: 47 PPPPPSNPSPPPPSPTTTACPPP 69 Score = 25.0 bits (52), Expect(2) = 7.6 Identities = 12/28 (42%), Positives = 13/28 (46%), Gaps = 1/28 (3%) Frame = +2 Query: 359 PPPPXP-XPAXXPPPXAPXPXPPPXXPP 439 PPPP P A PPP + P PP Sbjct: 56 PPPPSPTTTACPPPPSSSGGGPYYYYPP 83 Score = 21.8 bits (44), Expect(2) = 7.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 245 PXPXPPXPPPP 277 P P P PPPP Sbjct: 49 PPPSNPSPPPP 59 >At5g66960.1 68418.m08442 prolyl oligopeptidase family protein similar to OpdB [Treponema denticola] GI:13786054; contains Pfam profiles PF00326: prolyl oligopeptidase family, PF02897: Prolyl oligopeptidase, N-terminal beta-propeller domain Length = 792 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 26 PPKSPPPPPPPP 37 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP 409 PPPP P PA PP P Sbjct: 30 PPPPPPPPALPKPPKKP 46 >At5g56140.1 68418.m07003 KH domain-containing protein Length = 315 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 414 GXGAXGGGXXAGXGXGGGG 358 G G GGG G G GGGG Sbjct: 9 GGGGGGGGSGGGIGGGGGG 27 >At5g41460.1 68418.m05035 fringe-related protein strong similarity to unknown protein (pir||T13026) similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 524 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 97 PPPSPPPPPPPP 108 >At5g07510.1 68418.m00860 glycine-rich protein (GRP14) oleosin; glycine-rich protein 14 (GRP14) PMID:11431566; PIR:JQ1063 Length = 193 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = -3 Query: 438 GGXXGGGXGXGAXGGGXXAGXGXGGGG 358 GG G G G GGG G G GGG Sbjct: 107 GGRFGKPGGGGLGGGGLPGGLGGLGGG 133 >At4g23140.2 68417.m03338 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 680 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 254 PPLPPPPPPPPP 265 >At4g23140.1 68417.m03337 receptor-like protein kinase 5 (RLK5) identical to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam domain PF00069: Protein kinase domain; identical to cDNA receptor-like protein kinase 5 (RLK5) GI:13506746 Length = 674 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 254 PPLPPPPPPPPP 265 >At4g15150.1 68417.m02326 glycine-rich protein Length = 102 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = -3 Query: 435 GXXGGGXGXGAXGGGXXAGXGXGGGG 358 G GGG G GGG G GGG Sbjct: 37 GVSGGGRGLKKPGGGGGGGGATSGGG 62 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP + PPP +P P PP Sbjct: 254 PPPPYVYSSPPPPPYSPSPKVEFKSPP 280 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 28.3 bits (60), Expect = 8.0 Identities = 21/78 (26%), Positives = 27/78 (34%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP*IX 541 PPP P PPP P P PP P + + P + PP P Sbjct: 65 PPPPPYVYNSPPPPPPYIYNSPPRPPYVYK--SPPPPPFVYSSPPPPTYIYNSPPPPPYV 122 Query: 542 GGGKTXPLLXXIFXKGPP 595 K+ P + I+ PP Sbjct: 123 --YKSVPRITFIYSSPPP 138 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 28.3 bits (60), Expect = 8.0 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPP 424 PP P P P+ PPP P P Sbjct: 26 PPSPEPPPSPEPPPSPEKPTSP 47 >At3g28550.1 68416.m03565 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1018 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/98 (24%), Positives = 26/98 (26%), Gaps = 4/98 (4%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P P P PPP Sbjct: 538 PPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSPPPPYYSPSPKVVYKSPPPPYVYSSP 597 Query: 419 PPPXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 PPP P P P + P L + PP P Sbjct: 598 PPPYYSPSPK---VYYKSPPSPYHAPSPKVLYKSPPHP 632 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 204 PPPHPPPPPPPP 215 >At3g01560.1 68416.m00086 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 511 Score = 28.3 bits (60), Expect = 8.0 Identities = 18/77 (23%), Positives = 24/77 (31%), Gaps = 1/77 (1%) Frame = +3 Query: 405 PPXXP-PPPXPPPXXXXXXRXXAXXXSPPTGESLXXXSXXPXTPKXWGGEKPPPF*XKFX 581 PP P PPP PP S + P + E+ PP+ + Sbjct: 289 PPSHPQPPPSNPPPYQAPQTQTPHQPSYQSPPQQPQYPQQPPPSSGYNPEEQPPYQMQSY 348 Query: 582 XRGXPGXXPPXGGXPEK 632 P PP G P + Sbjct: 349 PPNPPRQQPPAGSTPSQ 365 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P PPP P + PP P Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPP-PVKSPPPPYVYSSPP 94 Query: 419 PPPXXPP 439 PP PP Sbjct: 95 PPVKSPP 101 Score = 28.3 bits (60), Expect = 8.0 Identities = 19/67 (28%), Positives = 20/67 (29%), Gaps = 4/67 (5%) Frame = +2 Query: 251 PXPPX----PPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPX 418 P PP PPPP P PPP P + PP P Sbjct: 132 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPP-PVKSPPPPYLYSSPP 190 Query: 419 PPPXXPP 439 PP PP Sbjct: 191 PPVKSPP 197 >At2g39750.1 68415.m04881 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 694 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 359 PPPPXPXPAXXPPP 400 PPPP P P+ PPP Sbjct: 108 PPPPPPSPSPPPPP 121 >At2g39250.1 68415.m04820 AP2 domain-containing transcription factor, putative AP2_ARATH Floral homeotic protein APETALA2.(SP:P47927){Arabidopsis thaliana} Length = 222 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 55 PPPPPPPPPPPP 66 >At2g30505.1 68415.m03716 Expressed protein Length = 321 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 6 PPPPPPPPPPPP 17 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 7 PPPPPPPPPPPP 18 >At1g76930.2 68414.m08956 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 256 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/100 (24%), Positives = 26/100 (26%), Gaps = 4/100 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP PPP P PPP P PP Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP-PVKYYSPPPVYKSPPPP 97 Query: 425 ----PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P P P + + PP P Sbjct: 98 VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 >At1g76930.1 68414.m08955 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 293 Score = 28.3 bits (60), Expect = 8.0 Identities = 24/100 (24%), Positives = 26/100 (26%), Gaps = 4/100 (4%) Frame = +2 Query: 245 PXPXPPXPPPPXXXPXXXXXXXXXXXAXXXXXXXXXXXPPPPXPXPAXXPPPXAPXPXPP 424 P P PPPP PPP P PPP P PP Sbjct: 39 PPPVYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPP-PVKYYSPPPVYKSPPPP 97 Query: 425 ----PXXPPXXXXXGXXXGXPGLPPNRGIPXXLXRXPPXP 532 P P P P P + + PP P Sbjct: 98 VYKSPPPPVKHYSPPPVYKSPPPPVKHYSPPPVYKSPPPP 137 >At1g69440.1 68414.m07979 PAZ domain-containing protein / piwi domain-containing protein similar to SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 990 Score = 28.3 bits (60), Expect = 8.0 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 1/24 (4%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAP-XPXPPP 427 PPPP P PP P P PPP Sbjct: 79 PPPPPPHLLPLSPPLPPLLPLPPP 102 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 28.3 bits (60), Expect = 8.0 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +2 Query: 359 PPPPXPXPAXXPPPXAPXPXPPPXXPP 439 PPPP P P PPP +P P PP Sbjct: 256 PPPPYPSP---PPPSSPLFSPLLPSPP 279 >At1g61750.1 68414.m06964 expressed protein contains Pfam profile: PF01657 domain of unknown function Length = 352 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 247 PPPPPPPPPPPP 258 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 248 PPPPPPPPPPPP 259 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 249 PPPPPPPPPPPP 260 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 250 PPPPPPPPPPPP 261 >At1g35830.1 68414.m04452 VQ motif-containing protein contains PF05678: VQ motif Length = 302 Score = 28.3 bits (60), Expect = 8.0 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 405 PPXXPPPPXPPP 440 PP PPPP PPP Sbjct: 81 PPQPPPPPPPPP 92 >At1g34000.2 68414.m04216 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 145 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P PP P PPP PP Sbjct: 56 PPTLREPQKPVPPSQPSSSPPPSPPP 81 >At1g34000.1 68414.m04215 light stress-responsive one-helix protein (OHP2) contains similarity to photosystem II 22 kDa protein GI:6006279 from [Arabidopsis thaliana] Length = 172 Score = 28.3 bits (60), Expect = 8.0 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 362 PPPXPXPAXXPPPXAPXPXPPPXXPP 439 PP P PP P PPP PP Sbjct: 56 PPTLREPQKPVPPSQPSSSPPPSPPP 81 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.317 0.159 0.615 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,462,652 Number of Sequences: 28952 Number of extensions: 302260 Number of successful extensions: 11379 Number of sequences better than 10.0: 247 Number of HSP's better than 10.0 without gapping: 872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4756 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2304931176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -