BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N09 (875 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 28 0.13 DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chlor... 25 1.2 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.9 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 22 8.5 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 27.9 bits (59), Expect = 0.13 Identities = 13/39 (33%), Positives = 24/39 (61%) Frame = -3 Query: 429 SLLRGDTVDCESALNIID*TKQFISLLN*DNIHKSSRIS 313 SLL+ +TV C+ A++++ + +++ DNIH IS Sbjct: 381 SLLKENTVTCQEAMHMLKNADSQLLVISDDNIHIKGVIS 419 >DQ667187-1|ABG75739.1| 428|Apis mellifera histamine-gated chloride channel protein. Length = 428 Score = 24.6 bits (51), Expect = 1.2 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 471 GSGRHTLDFTQLVLSLLRGDTVDCESALNIID 376 G G + + +VL LL G TVD + +L D Sbjct: 8 GGGMVSAILSSIVLLLLLGRTVDAQRSLEFFD 39 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.9 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 710 PXQXTPPGXXPXPPP 754 P Q PPG P PP Sbjct: 42 PSQGPPPGGPPGAPP 56 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 6.5 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 232 YFRRFLRKITRGKHSRNLWGPVDGLGAYTPPSLS 131 Y R +R T +H ++ +DG+G Y S S Sbjct: 83 YNRMDMRNATYYQHQQDHGSGMDGMGGYRSASPS 116 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.8 bits (44), Expect = 8.5 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 465 GRHTLDFTQLVLSLLRGDTVDCESALNIID*TKQFISL 352 G+ + T L+ ++L + CE +NI K ++SL Sbjct: 77 GQSAVGLTFLLGAILVQVAIICEGVMNIQKDNKSYLSL 114 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,055 Number of Sequences: 438 Number of extensions: 5126 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -