BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N08 (862 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 32 0.51 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 30 2.7 01_05_0679 + 24230740-24230929,24231330-24231461,24231710-242319... 29 4.8 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 28 8.3 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 28 8.3 06_01_0561 - 3983308-3983564,3983652-3983775 28 8.3 03_05_0825 - 27986393-27986767,27987541-27987625,27987936-279880... 28 8.3 02_05_0686 - 30900748-30902167,30903442-30904742 28 8.3 02_04_0382 - 22501041-22501279,22501717-22501810 28 8.3 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 25 9.1 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 32.3 bits (70), Expect = 0.51 Identities = 13/21 (61%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = +3 Query: 801 PPPPPGGXGGXXFFR-PPPXP 860 PPP GG GG F+R PPP P Sbjct: 19 PPPQAGGGGGGEFYRGPPPQP 39 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPP G F PPP P Sbjct: 548 PPPPPPPSGNKPAFSPPPPP 567 >01_05_0679 + 24230740-24230929,24231330-24231461,24231710-24231977, 24232170-24232388,24233538-24233673,24233899-24234147, 24234783-24235100 Length = 503 Score = 29.1 bits (62), Expect = 4.8 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = +2 Query: 188 INTLAESAKKTIEELR--EKVESALAPETVKKNFGTMVDSFNEFYKNLKPAE 337 ++ E A+K E L+ +K +L PE +K+ F +++ +F +F L+P E Sbjct: 254 VHATLEEARKFNEALQRWDKNAVSLVPEGLKRFFLSIMSNFRDFEDELEPHE 305 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPG GG PPP P Sbjct: 626 PPPPPGKPGGPP--PPPPRP 643 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPG GG PPP P Sbjct: 931 PPPPPGKPGGPP---PPPPP 947 >06_01_0561 - 3983308-3983564,3983652-3983775 Length = 126 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPP GG PPP P Sbjct: 87 PPPPTSNDGGIESISPPPPP 106 >03_05_0825 - 27986393-27986767,27987541-27987625,27987936-27988036, 27988144-27988227,27988868-27988939,27989203-27989319, 27989386-27989526,27989951-27990122,27990324-27990372, 27990773-27990821,27991240-27991270,27991301-27991371 Length = 448 Score = 28.3 bits (60), Expect = 8.3 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +2 Query: 170 PKEDNSINTLAESAKKTIEELREKVE 247 PKE ++ T+A + +KT EE+R +++ Sbjct: 91 PKESSTATTMAAATEKTAEEIRRELQ 116 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG G PPP P Sbjct: 366 PPPPPGGKKGGP---PPPPP 382 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 783 SPL*XXPPPPPGGXGGXXFFRPPPXP 860 SP PPP P GG + +PPP P Sbjct: 77 SPDYYDPPPSPYYGGGGGYGKPPPPP 102 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 25.0 bits (52), Expect(2) = 9.1 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPP G PPP P Sbjct: 94 PPPPPYGVNSSQPPPPPPPP 113 Score = 21.4 bits (43), Expect(2) = 9.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +3 Query: 777 FLSPL*XXPPPPPG 818 FL+P PPPPPG Sbjct: 51 FLAP---PPPPPPG 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,826,722 Number of Sequences: 37544 Number of extensions: 336466 Number of successful extensions: 1028 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 849 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 993 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -