BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N08 (862 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 29 6.2 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 29 6.2 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 29 6.2 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 29 6.2 AY071295-1|AAL48917.1| 227|Drosophila melanogaster RE32624p pro... 29 8.2 AE014134-2694|AAF53519.1| 227|Drosophila melanogaster CG5861-PA... 29 8.2 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG GG PPP P Sbjct: 514 PPPPPGG-GGAPPPPPPPMP 532 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG GG PPP P Sbjct: 514 PPPPPGG-GGAPPPPPPPMP 532 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG GG PPP P Sbjct: 514 PPPPPGG-GGAPPPPPPPMP 532 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 29.5 bits (63), Expect = 6.2 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 801 PPPPPGGXGGXXFFRPPPXP 860 PPPPPGG GG PPP P Sbjct: 514 PPPPPGG-GGAPPPPPPPMP 532 >AY071295-1|AAL48917.1| 227|Drosophila melanogaster RE32624p protein. Length = 227 Score = 29.1 bits (62), Expect = 8.2 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = -1 Query: 367 LKNYFSGFRCFR--GLQIFIKFVEAVYHRAKVFLNSLRGQGGFNFFPQFLNCFLRTLSQR 194 L Y + ++C + G+ IF + V+ + + ++ G FNFF + L C + Sbjct: 25 LSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSSSGEFNFFAEILRCSMDIADLL 84 Query: 193 IYAIVFFR 170 +A++ R Sbjct: 85 GFALILSR 92 >AE014134-2694|AAF53519.1| 227|Drosophila melanogaster CG5861-PA protein. Length = 227 Score = 29.1 bits (62), Expect = 8.2 Identities = 16/68 (23%), Positives = 32/68 (47%), Gaps = 2/68 (2%) Frame = -1 Query: 367 LKNYFSGFRCFR--GLQIFIKFVEAVYHRAKVFLNSLRGQGGFNFFPQFLNCFLRTLSQR 194 L Y + ++C + G+ IF + V+ + + ++ G FNFF + L C + Sbjct: 25 LSEYGAFWKCVQAGGIYIFTQLVKMLVLATFFYSDAPSSSGEFNFFAEILRCSMDIADLL 84 Query: 193 IYAIVFFR 170 +A++ R Sbjct: 85 GFALILSR 92 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,753,903 Number of Sequences: 53049 Number of extensions: 533280 Number of successful extensions: 1985 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1870 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4147514904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -