BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N07 (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch... 28 1.9 SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces po... 27 3.3 SPCC162.04c |wtf13||wtf element Wtf13|Schizosaccharomyces pombe|... 26 5.8 >SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosaccharomyces pombe|chr 2|||Manual Length = 2352 Score = 27.9 bits (59), Expect = 1.9 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 119 AIPFTVLEIPNIKIKKPTWLQAPSAMTTFSLVLLSYFLVTGGIIY 253 ++P + PN+ P+ P A F + L+ F+ GG++Y Sbjct: 2299 SLPVSDRVFPNLGAWNPSEGPGPCASPCFYIALICQFVAVGGLLY 2343 >SPCC1795.09 |yps1||aspartic protease Yps1|Schizosaccharomyces pombe|chr 3|||Manual Length = 521 Score = 27.1 bits (57), Expect = 3.3 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +2 Query: 110 GLFAIPFTVLEIPNIK--IKKPTWLQAPSAMTTFSLVLLSYFLVT 238 G+ A+ F PN + ++K + +PS +T+F L L SY T Sbjct: 24 GVLALDFVAKTFPNQENQLEKRDYTYSPSGITSFPLDLQSYTYYT 68 >SPCC162.04c |wtf13||wtf element Wtf13|Schizosaccharomyces pombe|chr 3|||Manual Length = 418 Score = 26.2 bits (55), Expect = 5.8 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 440 PKLNRILLISVAFLCILVSFFTTWI 514 P + +L + ++ L ++V FFT W+ Sbjct: 81 PNIYSLLRLLISVLAVIVVFFTAWV 105 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,712,192 Number of Sequences: 5004 Number of extensions: 56459 Number of successful extensions: 121 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 121 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -