BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N06 (876 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0676 + 4945361-4945531,4945632-4945811,4947145-4947300,494... 57 2e-08 02_05_0964 - 33133516-33133689,33133780-33133857,33133997-331341... 57 2e-08 09_04_0259 - 16182190-16182360,16183185-16183262,16184431-161845... 56 5e-08 07_03_1454 + 26652397-26652501,26653014-26653156,26654013-26654061 55 7e-08 03_03_0057 - 14132854-14133012,14133724-14133837,14134306-14134413 37 0.024 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 34 0.13 12_02_1174 - 26696869-26698191 33 0.40 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.40 10_08_0968 + 21933627-21933785,21933893-21933943,21934094-219341... 32 0.52 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 32 0.52 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 32 0.69 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 32 0.69 02_05_0686 - 30900748-30902167,30903442-30904742 32 0.69 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 29 1.2 12_02_0299 - 17051570-17052474,17053542-17053755 31 1.2 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 31 1.2 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 31 1.6 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 31 1.6 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 25 2.5 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 30 2.8 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 30 2.8 05_04_0011 + 17139322-17139451,17139552-17140174 25 3.6 07_03_0890 - 22332768-22333382 29 3.7 07_01_0080 + 587674-588510 29 3.7 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 29 3.7 03_05_0067 - 20460206-20460703,20461255-20461530 29 3.7 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 3.7 03_01_0515 - 3864796-3865425 29 3.7 02_04_0021 + 18975992-18976408 29 3.7 01_05_0490 + 22672241-22674679 29 3.7 01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827,896... 29 3.7 02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410,939... 25 4.5 12_01_0618 - 5099021-5099668,5099701-5100221,5100311-5100352,510... 29 4.9 12_01_0495 - 3935395-3937110 29 4.9 12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 29 4.9 12_01_0442 + 3495333-3496484 29 4.9 10_02_0009 + 4128909-4130123 29 4.9 07_03_1136 + 24218601-24218734,24218769-24219906 29 4.9 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 29 4.9 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 4.9 05_07_0031 - 27183252-27183317,27183542-27184282 29 4.9 05_01_0380 + 2978256-2979284 29 4.9 05_01_0210 + 1583176-1584177 29 4.9 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 29 4.9 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 29 4.9 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 4.9 03_05_0732 - 27232299-27232535,27232717-27232746,27233094-272331... 25 5.8 08_01_0493 - 4297761-4298288 25 6.3 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 29 6.5 08_01_0060 - 413088-413999 29 6.5 06_01_0666 - 4873797-4874057,4874327-4874455 29 6.5 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 6.5 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 6.5 10_08_0922 - 21593030-21593225,21593319-21594142 24 7.6 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 28 8.5 11_06_0016 - 19284810-19284926,19285527-19286879 28 8.5 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 28 8.5 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 28 8.5 08_02_0796 - 21300251-21300373,21300846-21301721 28 8.5 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 28 8.5 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 28 8.5 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 28 8.5 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 28 8.5 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 28 8.5 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 28 8.5 03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539,117... 28 8.5 01_01_0796 + 6190931-6192745 28 8.5 01_01_0715 - 5542648-5543219,5543352-5543544 28 8.5 01_01_0046 - 331758-332627 28 8.5 >06_01_0676 + 4945361-4945531,4945632-4945811,4947145-4947300, 4947460-4947537,4964041-4964214 Length = 252 Score = 56.8 bits (131), Expect = 2e-08 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = +1 Query: 148 VKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENGDFIPXS 324 VK + PL DRVLIK AEA KTAGG+++ E + K G VVAVGPG + G P S Sbjct: 156 VKDMKPLNDRVLIKVAEAEDKTAGGLILTETTKEKPSIGTVVAVGPGPLDDEGKRQPLS 214 Score = 51.6 bits (118), Expect = 8e-07 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +1 Query: 157 LVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPG 288 L PL DRVL+K A KT GGI++P AQSK GEVVAVG G Sbjct: 61 LKPLGDRVLVKLGAAEEKTVGGILLPSTAQSKPQGGEVVAVGEG 104 >02_05_0964 - 33133516-33133689,33133780-33133857,33133997-33134152, 33134685-33134864,33135516-33135695 Length = 255 Score = 56.8 bits (131), Expect = 2e-08 Identities = 31/58 (53%), Positives = 36/58 (62%) Frame = +1 Query: 151 KRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENGDFIPXS 324 K + PL DRVLIK AEA KT GG+++ E + K G VVAVGPG E G IP S Sbjct: 160 KDMKPLSDRVLIKVAEAEDKTPGGLLLTETTKEKPSIGTVVAVGPGPLDEEGKRIPLS 217 Score = 52.0 bits (119), Expect = 6e-07 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = +1 Query: 157 LVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPG 288 L PL DRVL+K A KT GGI++P AQSK GEVVA+G G Sbjct: 64 LKPLADRVLVKIKSAEQKTTGGILLPSAAQSKPQGGEVVAIGEG 107 >09_04_0259 - 16182190-16182360,16183185-16183262,16184431-16184586, 16184913-16185092,16185875-16186027 Length = 245 Score = 55.6 bits (128), Expect = 5e-08 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = +1 Query: 148 VKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENGDFIPXS 324 VK L PL DRVLIK AEA KTAGG+++ + + K G V AVGPG E+G P S Sbjct: 150 VKDLKPLNDRVLIKVAEAEEKTAGGLLLTQATKEKPSIGTVTAVGPGPLVEDGSRKPLS 208 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/54 (50%), Positives = 32/54 (59%) Frame = +1 Query: 163 PLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENGDFIPXS 324 PL DRVL+K + KT GGI++P QSK G+VVAVG G R D I S Sbjct: 57 PLGDRVLVKIKTSDDKTVGGILLPTSVQSKPQGGQVVAVGEG-RSMGSDSIEIS 109 >07_03_1454 + 26652397-26652501,26653014-26653156,26654013-26654061 Length = 98 Score = 55.2 bits (127), Expect = 7e-08 Identities = 26/56 (46%), Positives = 42/56 (75%) Frame = +1 Query: 151 KRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENGDFIP 318 +RL+P L+RVL+++ K+AGGI++PE ++ ++ G+VVAVGPG R ++G IP Sbjct: 3 RRLIPSLNRVLVEKLVQPKKSAGGILLPETSK-QLNSGKVVAVGPGERDKDGKLIP 57 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = +2 Query: 317 PXQVSVGDKVLLPEYGGTKVSLENDEKEYHLFRESDILAKI 439 P + GD VLLPEYGG +V L EKEY LFRE DIL + Sbjct: 57 PVALKEGDTVLLPEYGGLEVKLA-AEKEYLLFREHDILGTL 96 >03_03_0057 - 14132854-14133012,14133724-14133837,14134306-14134413 Length = 126 Score = 36.7 bits (81), Expect = 0.024 Identities = 18/29 (62%), Positives = 20/29 (68%) Frame = +2 Query: 317 PXQVSVGDKVLLPEYGGTKVSLENDEKEY 403 P + GD VLLPEYGGT+V L EKEY Sbjct: 96 PVSLKEGDTVLLPEYGGTEVKLA--EKEY 122 Score = 35.5 bits (78), Expect = 0.056 Identities = 14/31 (45%), Positives = 24/31 (77%) Frame = +1 Query: 145 AVKRLVPLLDRVLIKRAEAITKTAGGIVIPE 237 A +RL+P ++RVL+++ K+AGGI++PE Sbjct: 2 AARRLIPSMNRVLVEKLLQPNKSAGGILLPE 32 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 34.3 bits (75), Expect = 0.13 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P P PP P Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPP 454 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 431 PPPPPPPPPPPPPLPPNMPPPLPPP 455 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P P PP Sbjct: 432 PPPPPPPPPPPPLPPNMPPPLPPPP 456 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 434 PPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPP P P PP P Sbjct: 425 PPPPPLPPPPPPPPPPPPPLPPNMPP 450 >12_02_1174 - 26696869-26698191 Length = 440 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 153 PPPPPPPPPPPPPRPPSVKPPVVQP 177 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P P PP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPP 377 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P P PP Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 354 PPPPPPPPPPPPPPPPPPRPPPPPP 378 Score = 32.7 bits (71), Expect = 0.40 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPP P P P PP P Sbjct: 362 PPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXP 859 P P P PPPPP P P P Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P PP Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P PPPPP P P PP P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPP 374 >10_08_0968 + 21933627-21933785,21933893-21933943,21934094-21934129, 21935011-21935076,21935163-21935210,21936424-21936453, 21936651-21936719 Length = 152 Score = 32.3 bits (70), Expect = 0.52 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = +2 Query: 323 QVSVGDKVLLPEYGGTKVSLENDEKEYHLF-RESDILAKIE 442 +V G KVL + +V L DEK H F RESD+LA +E Sbjct: 114 EVEAGKKVLFSDINAYEVDLGTDEK--HCFCRESDLLAVVE 152 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 32.3 bits (70), Expect = 0.52 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 591 PPPLPNCLVPSPPPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPPPPP 640 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 566 PPPPPPPPPLPQSNYASSQPPPPPP 590 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPP 568 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 547 PPPPPPPPSGNKPAFSPPPPPPPPP 571 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPP 642 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPP 570 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 585 PPPPPPPPPLPNCLVPSPPPPPPPP 609 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P P PP P Sbjct: 600 PSPPPPPPP-PPILPNRSVPPPPPPP 624 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 803 PXPPPPPXXPXXPXXXXXPP 862 P PPPPP P P PP Sbjct: 634 PPPPPPPPPPSLPNRLVPPP 653 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 625 PPPPPPGKPGGPPPPPP 641 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 930 PPPPPPGKPGGPPPPPP 946 Score = 31.1 bits (67), Expect = 1.2 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +2 Query: 725 PXPPXXXXXXXXXXXXXXXXXPXXPX-PXPPPPPXXPXXPXXXXXPPXXXP 874 P PP P P P PPPPP P P PP P Sbjct: 902 PRPPPAPSATANTASALSPPPPRPPGAPPPPPPPGKPGGPPPPPPPPGSLP 952 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.9 bits (69), Expect = 0.69 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 366 PPPPPGGKKGGPPPPPP 382 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 788 PXXPXPX---PPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P P PP P Sbjct: 327 PPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPP 358 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PP PP P P PP Sbjct: 128 PEDPPPHPPHPPDHPPPPPPCRVPP 152 Score = 28.7 bits (61), Expect(2) = 1.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P P P P Sbjct: 117 PRPPPPPPPHPPEDPPPHPPHPPDHP 142 Score = 21.0 bits (42), Expect(2) = 1.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 788 PXXPXPXPPPPP 823 P P P PP PP Sbjct: 84 PPPPPPVPPCPP 95 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPP 863 PP PPPPP P P PP Sbjct: 320 PPPPPPPPPPPPPSFPWPFPP 340 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 318 PSPPPPPPPPPPPPPSFP 335 Score = 28.3 bits (60), Expect = 8.5 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 3/32 (9%) Frame = +2 Query: 788 PXXPXPXPPPPP---XXPXXPXXXXXPPXXXP 874 P P P PPPPP P P PP P Sbjct: 320 PPPPPPPPPPPPPSFPWPFPPLAPLFPPYPSP 351 Score = 27.9 bits (59), Expect(2) = 1.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P P P P Sbjct: 318 PSPPPPPPPPPPPPPSFPWPFPPLAP 343 Score = 21.8 bits (44), Expect(2) = 1.2 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +2 Query: 788 PXXPXPXPPPPP 823 P P PPPPP Sbjct: 282 PIFSPPSPPPPP 293 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPP 863 PP PPPPP P P PP Sbjct: 106 PPPPPPPPPSPPPSAPPPPPP 126 Score = 31.1 bits (67), Expect = 1.2 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPP 863 PP PPPPP P P PP Sbjct: 121 PPPPPPPPTQPPPREAQLAPP 141 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQP 131 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPP P P PP P Sbjct: 107 PPPPPPPPSPPPSAPPPPPPPPTQPP 132 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 30.7 bits (66), Expect = 1.6 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPP 862 P P PPPPP P P PP Sbjct: 1155 PLPPPPPPPLPPPPPVAPFHPP 1176 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 1158 PPPPPPLPPPPPVAPFHP 1175 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P PP P Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPPPP 379 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P PP P Sbjct: 350 PPPPPPPPPPPPPPPPKLNTAPKPPPPPP 378 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 25.0 bits (52), Expect(2) = 2.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 788 PXXPXPXPPPPP 823 P P P PPPPP Sbjct: 366 PPPPPPPPPPPP 377 Score = 23.4 bits (48), Expect(2) = 2.5 Identities = 8/15 (53%), Positives = 8/15 (53%) Frame = +2 Query: 797 PXPXPPPPPXXPXXP 841 P PPPPP P P Sbjct: 392 PAVPPPPPPTPPPPP 406 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 29.9 bits (64), Expect = 2.8 Identities = 16/51 (31%), Positives = 16/51 (31%), Gaps = 1/51 (1%) Frame = +1 Query: 727 PPPXXXXXXGGPP-PPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP GGPP PPPP PP P PP Sbjct: 1149 PPPPPVGGLGGPPAPPPPAGFRGGTPPPNAHGGVAPPPPPPRGHGGVGGPP 1199 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 29.9 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXP 859 P P P PPPPP P P P Sbjct: 39 PPPPPPPPPPPPPPPPPPLEVVSP 62 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P P P Sbjct: 38 PPPPPPPPPPPPPPPPPPPLEVVSP 62 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 25.4 bits (53), Expect(2) = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 801 PPXPPPPPXXP 833 PP PPPPP P Sbjct: 67 PPPPPPPPSPP 77 Score = 22.6 bits (46), Expect(2) = 3.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 810 PPPPPXXPXP 839 PPPPP P P Sbjct: 103 PPPPPPPPSP 112 >07_03_0890 - 22332768-22333382 Length = 204 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 86 PPPPPPPPERAVPEAADTPPPPPPP 110 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPP 109 >07_01_0080 + 587674-588510 Length = 278 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP G PPPPPP Sbjct: 93 PPPPPPPSSGSPPPPPP 109 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 92 PPPPPPPPSSGSPPPPPPPPPPPPP 116 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 104 PPPPPPPPPPPPPPPPPP 121 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPP P P PP P Sbjct: 1927 PPHAPPPPPPPPPVEGKPKPPPHAP 1951 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 1932 PPPPPPPPVEGKPKPPPHAPPPPPP 1956 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 29.5 bits (63), Expect = 3.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GPPPPPP Sbjct: 14 PPPPPQYFQAGPPPPPP 30 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPP P P PP P Sbjct: 264 PPRPPPPQVPPPPPQAPPPPPPNAP 288 >03_01_0515 - 3864796-3865425 Length = 209 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P PP Sbjct: 84 PPPPLPPPPPPPAASPPPPPPSPPP 108 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/50 (28%), Positives = 14/50 (28%) Frame = +2 Query: 725 PXPPXXXXXXXXXXXXXXXXXPXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P PP P P PPPPP P P P P Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PP PP P P PP P Sbjct: 83 PPPPPLPPPPPPPAASPPPPPPSPP 107 >02_04_0021 + 18975992-18976408 Length = 138 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPP P P PP Sbjct: 99 PPKPKPTPPPPAPTPKPPAPSPSPP 123 >01_05_0490 + 22672241-22674679 Length = 812 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P PP Sbjct: 692 PSPPLPPPPPPPPPPMSEGEEEAPP 716 >01_01_1130 + 8959909-8960396,8960588-8960638,8960736-8960827, 8960964-8961054,8961877-8961937,8962172-8962216, 8962318-8962391,8962565-8962637,8963288-8963345, 8963398-8963468,8963801-8963837,8964040-8964128, 8964207-8964263,8964366-8964449,8964529-8964627, 8964765-8964869,8965145-8965216,8965308-8965497, 8965810-8966207 Length = 744 Score = 29.5 bits (63), Expect = 3.7 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 79 PPSPPPPPPPPPTNGTLTPPPSSAP 103 >02_02_0359 - 9390175-9390416,9390924-9391044,9391069-9391410, 9392400-9392759 Length = 354 Score = 24.6 bits (51), Expect(2) = 4.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +2 Query: 803 PXPPPPPXXPXXP 841 P PPPPP P P Sbjct: 38 PPPPPPPPPPSQP 50 Score = 23.0 bits (47), Expect(2) = 4.5 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +2 Query: 797 PXPXPPPPP 823 P P PPPPP Sbjct: 37 PPPPPPPPP 45 >12_01_0618 - 5099021-5099668,5099701-5100221,5100311-5100352, 5100905-5100962 Length = 422 Score = 29.1 bits (62), Expect = 4.9 Identities = 12/19 (63%), Positives = 16/19 (84%) Frame = +3 Query: 126 KNRNGQCSKTIGSSSGPCP 182 K++N +C KT+ SSSGPCP Sbjct: 236 KDKN-ECLKTMRSSSGPCP 253 >12_01_0495 - 3935395-3937110 Length = 571 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 5 PPPPLPPPPPPPPPPATP 22 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P PP Sbjct: 8 PLPPPPPPPPPPATPQQNKAVELPP 32 >12_01_0477 + 3742751-3745200,3747192-3747502,3747886-3748232 Length = 1035 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 3 PLPPLPSPPPPPTPPPSP 20 >12_01_0442 + 3495333-3496484 Length = 383 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 214 PTAPAPAPPPPPPQPASP 231 >10_02_0009 + 4128909-4130123 Length = 404 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 79 PSPPSPPPPPPPPPPQQP 96 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 776 GGGGGGPPXXXXXXGGG 726 GGGGGGPP GGG Sbjct: 111 GGGGGGPPSLPPGAGGG 127 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 776 GGGGGGPPXXXXXXGGG 726 GGGGGGPP GGG Sbjct: 62 GGGGGGPPYYGGGGGGG 78 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 227 PPLPPPPPPPPKPANIAGAPGLPLP 251 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 29.1 bits (62), Expect = 4.9 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P P P P Sbjct: 113 PQPSPPPPPPPPPPPPTTTTKPESLP 138 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 26 PPPPPPPPPPPPPPPPRP 43 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 29 PPPPPPPPPPPPPRPFSRKP 48 >05_01_0210 + 1583176-1584177 Length = 333 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 30 PLPPPPPPPPPPLLPADP 47 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 19 PPAPAPVPPPPPPPPPPP 36 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 2 PPPPPPPPPPPPSPPRLP 19 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 29.1 bits (62), Expect = 4.9 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 76 PPPPPPPPPPPPPVPVPP 93 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPP 863 P PPPPP P P PP Sbjct: 74 PSPPPPPPPPPPPPPVPVPP 93 Score = 23.8 bits (49), Expect(2) = 5.5 Identities = 11/39 (28%), Positives = 11/39 (28%) Frame = +1 Query: 760 PPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPPPPP PP P PP Sbjct: 79 PPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRPP 117 Score = 23.4 bits (48), Expect(2) = 5.5 Identities = 8/16 (50%), Positives = 8/16 (50%) Frame = +1 Query: 730 PPXXXXXXGGPPPPPP 777 PP PPPPPP Sbjct: 66 PPAGIAVHPSPPPPPP 81 >03_05_0732 - 27232299-27232535,27232717-27232746,27233094-27233155, 27233975-27234005,27234618-27234713,27234881-27234969, 27235687-27236263 Length = 373 Score = 25.0 bits (52), Expect(2) = 5.8 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 788 PXXPXPXPPPPP 823 P P P PPPPP Sbjct: 51 PHQPPPPPPPPP 62 Score = 22.2 bits (45), Expect(2) = 5.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 809 PPPPPXXPXXP 841 PPPPP P P Sbjct: 54 PPPPPPPPPLP 64 >08_01_0493 - 4297761-4298288 Length = 175 Score = 25.0 bits (52), Expect(2) = 6.3 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +2 Query: 788 PXXPXPXPPPPP 823 P P P PPPPP Sbjct: 112 PAVPPPPPPPPP 123 Score = 22.2 bits (45), Expect(2) = 6.3 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +2 Query: 809 PPPPPXXPXXP 841 PPPPP P P Sbjct: 115 PPPPPPPPPSP 125 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 220 PPPPPPPPPSPHRHPAAHPPPPPHHP 245 >08_01_0060 - 413088-413999 Length = 303 Score = 28.7 bits (61), Expect = 6.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 30 PPPPPPPPPPPLPFHLHHHPLDPSP 54 >06_01_0666 - 4873797-4874057,4874327-4874455 Length = 129 Score = 28.7 bits (61), Expect = 6.5 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 219 RHCHPREGSIQGFTRRSSSGRSWSPKRKWRLHPRFK 326 RHC + ++ RR S G SW +R W + P F+ Sbjct: 45 RHCRRQRTWVR--RRRRSGGGSWCRRRTWLVMPVFR 78 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP G PPPPPP Sbjct: 412 PPPPPTHTHGPPPPPPP 428 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP G PPPPPP Sbjct: 115 PPPHLLHYYGHPPPPPP 131 >10_08_0922 - 21593030-21593225,21593319-21594142 Length = 339 Score = 24.2 bits (50), Expect(2) = 7.6 Identities = 11/38 (28%), Positives = 11/38 (28%) Frame = +1 Query: 760 PPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXP 873 PPPPPP PP P P P Sbjct: 184 PPPPPPPMYHQYHHHAVHMAPMLPPPPPVAELNPMASP 221 Score = 22.6 bits (46), Expect(2) = 7.6 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +1 Query: 754 GGPPPPPP 777 G PPPPPP Sbjct: 181 GTPPPPPP 188 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 40 PPPPPPPPPPPAPAPALLAP 59 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 89 PPPPPPPPPRPAPSLASALP 108 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 79 PPSPPPPPPPPPPPPPPLSP 98 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.3 bits (60), Expect = 8.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 55 PPPPPPPPAPFFPFLPDSAPPQLPP 79 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 104 PPPPPPPPPPPPPQPQQHLP 123 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 18 PPPPPPPPPPPLPPRGSPAP 37 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 803 PXPPPPPXXPXXPXXXXXPP 862 P PPPPP P P PP Sbjct: 1180 PPPPPPPPLPSGPPPQPAPP 1199 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPP 863 P PPPPP P P PP Sbjct: 89 PTPPPPPPPPLPQHRLEPPP 108 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 308 PPPPPPPPPPPMPRSRSASP 327 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPP 863 P PPPPP P P PP Sbjct: 36 PSPPPPPPSPVPSPAPPPPP 55 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 28.3 bits (60), Expect = 8.5 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P P PP Sbjct: 47 PSPPRPPPPPPP--PTQPAPPPPPP 69 >03_01_0149 - 1175689-1176258,1176345-1176509,1176631-1177539, 1178179-1178378,1178505-1178605,1178747-1179369, 1179451-1179546,1179637-1179798,1179889-1180068, 1180173-1180323,1180408-1180641,1180753-1180913, 1181041-1181163,1181261-1181421,1181655-1181877, 1181952-1182346,1182461-1182671,1183536-1184522 Length = 1883 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPP 863 P PPPPP P P PP Sbjct: 75 PAPPPPPPPPLPEPVPVAPP 94 >01_01_0796 + 6190931-6192745 Length = 604 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXP 860 PP PPPPP P P P Sbjct: 193 PPPPPPPPPPPQPEQQLQLP 212 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 803 PXPPPPPXXPXXPXXXXXPP 862 P PPPPP P P PP Sbjct: 143 PSPPPPPTVPAAPTPRPSPP 162 >01_01_0046 - 331758-332627 Length = 289 Score = 28.3 bits (60), Expect = 8.5 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPP 863 P PPPPP P P PP Sbjct: 21 PPPPPPPPPPPPSSSRYRPP 40 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,855,172 Number of Sequences: 37544 Number of extensions: 457530 Number of successful extensions: 11911 Number of sequences better than 10.0: 69 Number of HSP's better than 10.0 without gapping: 2535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7580 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2467979640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -