BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N06 (876 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY070696-1|AAL48167.1| 103|Drosophila melanogaster RH34413p pro... 84 3e-16 AE014296-2229|AAF49856.1| 103|Drosophila melanogaster CG11267-P... 84 3e-16 AY075297-1|AAL68164.1| 102|Drosophila melanogaster AT30951p pro... 71 2e-12 AE014297-1794|AAF55015.1| 102|Drosophila melanogaster CG9920-PA... 71 2e-12 U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino pro... 33 0.68 BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p pro... 33 0.68 BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p pro... 33 0.68 AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p pro... 33 0.68 AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA... 33 0.68 AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA,... 33 0.68 AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB,... 33 0.68 AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD,... 33 0.68 AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC,... 33 0.68 EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-pepti... 32 0.90 U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous pro... 32 1.2 BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p pro... 32 1.2 AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB... 32 1.2 AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA... 32 1.2 BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p pro... 31 1.6 AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA... 31 1.6 AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p pro... 31 2.1 AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-P... 31 2.1 AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA... 31 2.1 BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p pro... 30 4.8 AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p pro... 30 4.8 AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA... 30 4.8 AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-P... 30 4.8 AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA... 30 4.8 AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p pro... 29 6.4 AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 p... 29 6.4 AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB,... 29 6.4 AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-P... 29 6.4 X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.me... 29 8.4 M19692-1|AAA28934.1| 1520|Drosophila melanogaster protein ( D.me... 29 8.4 AY058497-1|AAL13726.1| 1249|Drosophila melanogaster LD03455p pro... 29 8.4 AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB... 29 8.4 AE014296-2776|AAF49431.2| 1620|Drosophila melanogaster CG4032-PA... 29 8.4 >AY070696-1|AAL48167.1| 103|Drosophila melanogaster RH34413p protein. Length = 103 Score = 83.8 bits (198), Expect = 3e-16 Identities = 39/62 (62%), Positives = 50/62 (80%), Gaps = 1/62 (1%) Frame = +1 Query: 136 MANAVKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARK-ENGDF 312 MA A+K+++P+LDR+LI+RAEA+TKT GGIV+PEKA KVL G V+AVGPG R G+ Sbjct: 1 MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNH 60 Query: 313 IP 318 IP Sbjct: 61 IP 62 Score = 65.7 bits (153), Expect = 8e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 317 PXQVSVGDKVLLPEYGGTKVSLENDEKEYHLFRESDILAKIE 442 P V GD+VLLPE+GGTKV+LE D+KE LFRESDILAK+E Sbjct: 62 PIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE 103 >AE014296-2229|AAF49856.1| 103|Drosophila melanogaster CG11267-PA protein. Length = 103 Score = 83.8 bits (198), Expect = 3e-16 Identities = 39/62 (62%), Positives = 50/62 (80%), Gaps = 1/62 (1%) Frame = +1 Query: 136 MANAVKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARK-ENGDF 312 MA A+K+++P+LDR+LI+RAEA+TKT GGIV+PEKA KVL G V+AVGPG R G+ Sbjct: 1 MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGPGTRNASTGNH 60 Query: 313 IP 318 IP Sbjct: 61 IP 62 Score = 65.7 bits (153), Expect = 8e-11 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = +2 Query: 317 PXQVSVGDKVLLPEYGGTKVSLENDEKEYHLFRESDILAKIE 442 P V GD+VLLPE+GGTKV+LE D+KE LFRESDILAK+E Sbjct: 62 PIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILAKLE 103 >AY075297-1|AAL68164.1| 102|Drosophila melanogaster AT30951p protein. Length = 102 Score = 70.9 bits (166), Expect = 2e-12 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = +1 Query: 136 MANAVKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENG 306 M+N +K+++P+LDR+LI+R E T TAGGI++PE++ K + G VVAVGPGAR G Sbjct: 1 MSNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAG 57 Score = 58.0 bits (134), Expect = 2e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 326 VSVGDKVLLPEYGGTKVSLENDEKEYHLFRESDILAKIE 442 V GD+VLLP+YGGTKV ++ D++EY LFRESDILAK+E Sbjct: 65 VKEGDRVLLPKYGGTKVDMD-DKREYVLFRESDILAKLE 102 >AE014297-1794|AAF55015.1| 102|Drosophila melanogaster CG9920-PA protein. Length = 102 Score = 70.9 bits (166), Expect = 2e-12 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = +1 Query: 136 MANAVKRLVPLLDRVLIKRAEAITKTAGGIVIPEKAQSKVLHGEVVAVGPGARKENG 306 M+N +K+++P+LDR+LI+R E T TAGGI++PE++ K + G VVAVGPGAR G Sbjct: 1 MSNVIKKVIPMLDRILIQRFEVKTTTAGGILLPEESVPKEMQGVVVAVGPGARNPAG 57 Score = 58.0 bits (134), Expect = 2e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 326 VSVGDKVLLPEYGGTKVSLENDEKEYHLFRESDILAKIE 442 V GD+VLLP+YGGTKV ++ D++EY LFRESDILAK+E Sbjct: 65 VKEGDRVLLPKYGGTKVDMD-DKREYVLFRESDILAKLE 102 >U34258-1|AAC46925.1| 1058|Drosophila melanogaster cappuccino protein. Length = 1058 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 500 PPPPPPPPPPPPPLANYGAPPPPPP 524 Score = 31.9 bits (69), Expect = 1.2 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 489 PPPPPLPAFVAPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 538 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 502 PPPPPPPPPPPLANYGAPPPPPPPP 526 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 500 PPPPPPPPPPPPPLANYGAPPPPPPP 525 >BT024458-1|ABC86520.1| 1153|Drosophila melanogaster AT18380p protein. Length = 1153 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 595 PPPPPPPPPPPPPMANYGAPPPPPP 619 Score = 31.9 bits (69), Expect = 1.2 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 584 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 633 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 597 PPPPPPPPPPPMANYGAPPPPPPPP 621 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 595 PPPPPPPPPPPPPMANYGAPPPPPPP 620 >BT021476-1|AAX33624.1| 1286|Drosophila melanogaster AT04667p protein. Length = 1286 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 728 PPPPPPPPPPPPPMANYGAPPPPPP 752 Score = 31.9 bits (69), Expect = 1.2 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 717 PPPPPLPAFVAPPPPPPPPPPPPPMANYGAPPPPPPPPPGSGSAPPPPPP 766 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 730 PPPPPPPPPPPMANYGAPPPPPPPP 754 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 728 PPPPPPPPPPPPPMANYGAPPPPPPP 753 >AY119486-1|AAM50140.1| 1049|Drosophila melanogaster GH07742p protein. Length = 1049 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 491 PPPPPPPPPPPPPLANYGAPPPPPP 515 Score = 32.3 bits (70), Expect = 0.90 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPP 514 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 493 PPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 491 PPPPPPPPPPPPPLANYGAPPPPPPP 516 >AE014134-733|AAO41157.1| 579|Drosophila melanogaster CG33003-PA protein. Length = 579 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 463 PPPPPPPPPPPPPPPPPTEPPPPPP 487 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPP 488 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P P PP Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPP 489 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 465 PPPPPPPPPPPPPPPTEPPPPPPPP 489 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 466 PPPPPPPPPPPPPPTEPPPPPPPPP 490 Score = 31.1 bits (67), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P PP P Sbjct: 464 PPPPPPPPPPPPPPPPTEPPPPPPPPPEP 492 >AE014134-691|AAF51054.1| 1059|Drosophila melanogaster CG3399-PA, isoform A protein. Length = 1059 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 501 PPPPPPPPPPPPPLANYGAPPPPPP 525 Score = 32.3 bits (70), Expect = 0.90 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 490 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 539 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 500 PPPPPPPPPPPPPPLANYGAPPPPP 524 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 503 PPPPPPPPPPPLANYGAPPPPPPPP 527 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 501 PPPPPPPPPPPPPLANYGAPPPPPPP 526 >AE014134-690|AAN10367.1| 1049|Drosophila melanogaster CG3399-PB, isoform B protein. Length = 1049 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 491 PPPPPPPPPPPPPLANYGAPPPPPP 515 Score = 32.3 bits (70), Expect = 0.90 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 480 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 529 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 490 PPPPPPPPPPPPPPLANYGAPPPPP 514 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 493 PPPPPPPPPPPLANYGAPPPPPPPP 517 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 491 PPPPPPPPPPPPPLANYGAPPPPPPP 516 >AE014134-689|AAF51053.2| 1207|Drosophila melanogaster CG3399-PD, isoform D protein. Length = 1207 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 649 PPPPPPPPPPPPPLANYGAPPPPPP 673 Score = 32.3 bits (70), Expect = 0.90 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 638 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 687 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 648 PPPPPPPPPPPPPPLANYGAPPPPP 672 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 651 PPPPPPPPPPPLANYGAPPPPPPPP 675 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 649 PPPPPPPPPPPPPLANYGAPPPPPPP 674 >AE014134-688|AAN10366.1| 1154|Drosophila melanogaster CG3399-PC, isoform C protein. Length = 1154 Score = 32.7 bits (71), Expect = 0.68 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P PP P Sbjct: 596 PPPPPPPPPPPPPLANYGAPPPPPP 620 Score = 32.3 bits (70), Expect = 0.90 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXPXXXPP 876 PPP PPPPPP PP P P PP Sbjct: 585 PPPPLHAFVAPPPPPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPPPP 634 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 595 PPPPPPPPPPPPPPLANYGAPPPPP 619 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 598 PPPPPPPPPPPLANYGAPPPPPPPP 622 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P PP P Sbjct: 596 PPPPPPPPPPPPPLANYGAPPPPPPP 621 >EF108315-1|ABL09495.1| 528|Drosophila melanogaster serine-peptidase protein. Length = 528 Score = 32.3 bits (70), Expect = 0.90 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPPP P P PP P Sbjct: 227 PAPPPPPPPPLPTPPAVVTVPPATPP 252 >U11288-1|AAA67715.1| 1091|Drosophila melanogaster diaphanous protein protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 528 PPPMPGRAGGGPPPPPP 544 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 543 PPPPMPGRAGGPPPPPP 559 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPP 774 PPP GGPPPPP Sbjct: 555 PPPPPPPGMGGPPPPP 570 >BT021398-1|AAX33546.1| 1091|Drosophila melanogaster LD14246p protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 528 PPPMPGRAGGGPPPPPP 544 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 543 PPPPMPGRAGGPPPPPP 559 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPP 774 PPP GGPPPPP Sbjct: 555 PPPPPPPGMGGPPPPP 570 >AE014134-3281|AAN11087.1| 1091|Drosophila melanogaster CG1768-PB, isoform B protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 528 PPPMPGRAGGGPPPPPP 544 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 543 PPPPMPGRAGGPPPPPP 559 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPP 774 PPP GGPPPPP Sbjct: 555 PPPPPPPGMGGPPPPP 570 >AE014134-3280|AAF53922.1| 1091|Drosophila melanogaster CG1768-PA, isoform A protein. Length = 1091 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 528 PPPMPGRAGGGPPPPPP 544 Score = 31.9 bits (69), Expect = 1.2 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPP 777 PPP GGPPPPPP Sbjct: 543 PPPPMPGRAGGPPPPPP 559 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPP 774 PPP GGPPPPP Sbjct: 555 PPPPPPPGMGGPPPPP 570 >BT023940-1|ABB36444.1| 592|Drosophila melanogaster LP20233p protein. Length = 592 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 725 PXPPXXXXXXXXXXXXXXXXXPXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P PP P P P PPPPP P PP P Sbjct: 216 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP 265 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P P P P Sbjct: 150 PAPPPPPPPPPPPPPPPPPPHSHPHSHHP 178 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 161 PPPPPPPPPHSHPHSHHPHPPIVTP 185 >AE014297-2291|AAF55377.2| 594|Drosophila melanogaster CG5225-PA protein. Length = 594 Score = 31.5 bits (68), Expect = 1.6 Identities = 15/50 (30%), Positives = 15/50 (30%) Frame = +2 Query: 725 PXPPXXXXXXXXXXXXXXXXXPXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P PP P P P PPPPP P PP P Sbjct: 218 PGPPGTGPPGPPGPPGTTYPQPPPPPPPPPPPPPSYPYPPYPYPPPGPYP 267 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P P P P Sbjct: 152 PAPPPPPPPPPPPPPPPPPPHSHPHSHHP 180 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 163 PPPPPPPPPHSHPHSHHPHPPIVTP 187 >AY071124-1|AAL48746.1| 420|Drosophila melanogaster RE17165p protein. Length = 420 Score = 31.1 bits (67), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P PP P Sbjct: 203 PSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPP P P PP P Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQP 100 >AE014297-3551|AAF56299.2| 290|Drosophila melanogaster CG13615-PA protein. Length = 290 Score = 31.1 bits (67), Expect = 2.1 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPP 863 PP PPPPP P P PP Sbjct: 74 PPPPPPPPPPPPPPPPPPSPP 94 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P P P P Sbjct: 76 PPPPPPPPPPPPPPPPSPPGVPANPVSLP 104 Score = 30.7 bits (66), Expect = 2.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P P P P Sbjct: 77 PPPPPPPPPPPPPPPSPPGVPANPVSLPP 105 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXP 859 P P P PPPPP P P P Sbjct: 74 PPPPPPPPPPPPPPPPPPSPPGVP 97 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P P P P Sbjct: 73 PPPPPPPPPPPPPPPPPPPSPPGVP 97 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 73 PPPPPPPPPPPPPPPPPP 90 >AE014296-850|AAF47902.2| 420|Drosophila melanogaster CG15021-PA protein. Length = 420 Score = 31.1 bits (67), Expect = 2.1 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P P PPPPP P PP P Sbjct: 203 PSRPQPPPPPPPRPQPTPGYGPPPPPPPP 231 Score = 29.1 bits (62), Expect = 8.4 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +2 Query: 797 PXPXPPPPPXXPXXPXXXXXPPXXXP 874 P P PPPP P P PP P Sbjct: 75 PPPPPPPPQPTPPAPRPSYGPPQTQP 100 >BT001437-1|AAN71192.1| 195|Drosophila melanogaster GH24648p protein. Length = 195 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXP 859 P P P PPPPP P P P Sbjct: 46 PPYPAPPPPPPPFQPIGPLIPPQP 69 >AY069683-1|AAL39828.1| 993|Drosophila melanogaster LD45449p protein. Length = 993 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXP 861 PPP GPPPPPP PP P P Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPP 479 >AE014298-2035|AAF48374.1| 993|Drosophila melanogaster CG9411-PA protein. Length = 993 Score = 29.9 bits (64), Expect = 4.8 Identities = 14/45 (31%), Positives = 14/45 (31%) Frame = +1 Query: 727 PPPXXXXXXGGPPPPPPXXXXXXXXXXXXXXXXXPPXPXXXXXXP 861 PPP GPPPPPP PP P P Sbjct: 435 PPPPPPSGNYGPPPPPPSGNYGPPPPPPSGNYGPPPPPSGNYGPP 479 >AE014296-2897|AAF49349.4| 926|Drosophila melanogaster CG13731-PA protein. Length = 926 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPPXXXP 875 P PPPPP P P PP P Sbjct: 228 PPPPPPPRTPPPTRPPTRPPTTRP 251 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 804 PXPPPPPXXPXPXXXXXXPPXXXP 875 P PPPPP P P PP P Sbjct: 314 PPPPPPPRTPPPTRPPTKPPTTRP 337 >AE014296-776|AAN11589.1| 575|Drosophila melanogaster CG32260-PA protein. Length = 575 Score = 29.9 bits (64), Expect = 4.8 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXP 859 P P P PPPPP P P P Sbjct: 46 PPYPAPPPPPPPFQPIGPLIPPQP 69 >AY118440-1|AAM48469.1| 499|Drosophila melanogaster RH66493p protein. Length = 499 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P PP Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPP 360 >AL031366-1|CAA20520.1| 809|Drosophila melanogaster EG:100G7.6 protein. Length = 809 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 644 PPPPPPPPPPPQTCCAPVRPPYAPP 668 >AE014298-475|AAF45833.2| 887|Drosophila melanogaster CG3588-PB, isoform B protein. Length = 887 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 801 PPXPPPPPXXPXPXXXXXXPPXXXP 875 PP PPPPP P PP P Sbjct: 784 PPPPPPPPPPPQTCCAPVRPPYAPP 808 >AE013599-1412|AAF58562.1| 499|Drosophila melanogaster CG13176-PA protein. Length = 499 Score = 29.5 bits (63), Expect = 6.4 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXPXXXXXPP 862 P P P PPPPP P PP Sbjct: 336 PPPPPPPPPPPPPPPAQTSAIPSPP 360 >X15586-1|CAA33611.1| 1443|Drosophila melanogaster protein ( D.melanogaster 75B mRNAencoding hypothetical 75B protein. ). Length = 1443 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 268 PLAPPPPPPPPPPPPPPP 285 >M19692-1|AAA28934.1| 1520|Drosophila melanogaster protein ( D.melanogaster tyrosinekinase gene, exons 3 to 10 (with a region homologous tothe Abelson oncogene). ). Length = 1520 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 730 PPXXXXXXGGPPPPPP 777 PP GGPPPPPP Sbjct: 1080 PPPPEEFEGGPPPPPP 1095 >AY058497-1|AAL13726.1| 1249|Drosophila melanogaster LD03455p protein. Length = 1249 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 730 PPXXXXXXGGPPPPPP 777 PP GGPPPPPP Sbjct: 692 PPPPEEFEGGPPPPPP 707 >AE014296-2989|AAF49282.3| 1412|Drosophila melanogaster CG8127-PB, isoform B protein. Length = 1412 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +2 Query: 788 PXXPXPXPPPPPXXPXXP 841 P P P PPPPP P P Sbjct: 266 PLAPPPPPPPPPPPPPPP 283 >AE014296-2776|AAF49431.2| 1620|Drosophila melanogaster CG4032-PA protein. Length = 1620 Score = 29.1 bits (62), Expect = 8.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 730 PPXXXXXXGGPPPPPP 777 PP GGPPPPPP Sbjct: 1063 PPPPEEFEGGPPPPPP 1078 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,572,961 Number of Sequences: 53049 Number of extensions: 699755 Number of successful extensions: 11024 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 2594 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7046 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 4250176164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -