BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N05 (860 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 0.89 02_05_0686 - 30900748-30902167,30903442-30904742 31 1.2 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 31 1.6 08_01_0059 - 394001-394708 30 2.1 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 30 2.1 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 30 2.1 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 29 3.6 11_01_0066 - 536281-537196,537397-537452 29 4.8 06_03_1172 - 28147957-28148274,28149362-28149877 29 4.8 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 29 4.8 09_02_0603 - 11150739-11150746,11150791-11151340 29 6.3 08_02_0758 + 20848078-20849579,20849660-20849850,20849944-208501... 29 6.3 07_01_0080 + 587674-588510 29 6.3 10_07_0187 - 13919143-13919901 25 7.7 10_08_0940 - 21708557-21708733,21709058-21709142,21709330-217095... 28 8.3 07_03_0890 - 22332768-22333382 28 8.3 04_03_1022 - 21778315-21779007 28 8.3 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 28 8.3 03_02_0786 - 11169820-11170158,11170245-11170433,11171173-111714... 28 8.3 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.5 bits (68), Expect = 0.89 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP P PPPPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPP 570 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP PPPPP Sbjct: 545 PPPPPPPPPPSGNKPAFSPPPPPPPPP 571 Score = 28.3 bits (60), Expect = 8.3 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 703 GXXPPPPGKKXPPXXXXXPLXXXXXPPPPP 792 G PPPP P P PPPPP Sbjct: 688 GPPPPPPPPLPPANRTNGPGVPSAPPPPPP 717 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 31.1 bits (67), Expect = 1.2 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +1 Query: 703 GXXPPPPGKKXPPXXXXXPLXXXXXPPPPP 792 G PPPP K PP P PPPPP Sbjct: 343 GPPPPPPAKGPPPPPP--PKGPSPPPPPPP 370 Score = 30.7 bits (66), Expect = 1.6 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +1 Query: 703 GXXPPPPGKKXPPXXXXXPLXXXXXPPPPP 792 G PPPP K P P PPPPP Sbjct: 352 GPPPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 28.3 bits (60), Expect = 8.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP K PP P PPPPP Sbjct: 336 PPPPPPKGPP---PPPPAKGPPPPPPP 359 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 30.7 bits (66), Expect = 1.6 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP P PPPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPRPPPPPPP 379 >08_01_0059 - 394001-394708 Length = 235 Score = 30.3 bits (65), Expect = 2.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPP 789 PPPP ++ PP P PPPP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPP 28 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP + PP P PPP P Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSP 30 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP P PPPPP Sbjct: 252 PPPPPPPGPPPREIVPGQTLLPPPPPP 278 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 30.3 bits (65), Expect = 2.1 Identities = 12/27 (44%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP L PPPPP Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPPPP 377 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP PPPPP Sbjct: 354 PPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPP 789 PPPP PP P PPPP Sbjct: 356 PPPPPPPPPPKLNTAPKPPPPPPPPP 381 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP + PP P+ PPPP Sbjct: 273 PPPPPQAPPPPPPNAPMGMPPRIPPPP 299 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 29.1 bits (62), Expect = 4.8 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP P P PPP Sbjct: 230 PPPPSTATPPPPSPTPTTTRASPTPPP 256 >06_03_1172 - 28147957-28148274,28149362-28149877 Length = 277 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 700 GGXXPPPPGKKXPPXXXXXPLXXXXXPPPP 789 GG PPPP P P PPPP Sbjct: 7 GGGAPPPPPPSPPSVYPFLPPATFIPPPPP 36 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 700 GGXXPPPPGKKXPPXXXXXPLXXXXXPPPP 789 G PPPPG P P PPPP Sbjct: 421 GAPPPPPPGSYAPVPWGQPPPYASYPPPPP 450 Score = 29.1 bits (62), Expect = 4.8 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 703 GXXPPPPGKKXPPXXXXXPLXXXXXPPPPP 792 G PPPP P P PPPPP Sbjct: 421 GAPPPPPPGSYAPVPWGQPPPYASYPPPPP 450 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 28.7 bits (61), Expect = 6.3 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP PL PPPPP Sbjct: 44 PPPP----PPGSTFVPLPQSGVPPPPP 66 >08_02_0758 + 20848078-20849579,20849660-20849850,20849944-20850179, 20850254-20850973 Length = 882 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPP 789 PPPP +K PP PPPP Sbjct: 430 PPPPPQKNPPPNLKGQCYGQPPPPPP 455 >07_01_0080 + 587674-588510 Length = 278 Score = 28.7 bits (61), Expect = 6.3 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPP 789 PPPP PP P PPPP Sbjct: 96 PPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP P P PPPPP Sbjct: 95 PPPPPSSGSPPPPPPPPPPPPPPPPPP 121 >10_07_0187 - 13919143-13919901 Length = 252 Score = 24.6 bits (51), Expect(2) = 7.7 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 758 PSXSXXPPPPPP 793 P+ S PPPPPP Sbjct: 47 PAPSSDPPPPPP 58 Score = 22.2 bits (45), Expect(2) = 7.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +2 Query: 767 SXXPPPPPPXXXXK 808 S PPPPPP K Sbjct: 51 SDPPPPPPPDPSGK 64 >10_08_0940 - 21708557-21708733,21709058-21709142,21709330-21709551, 21710640-21710815,21711883-21711946,21712433-21712507, 21715114-21715199,21715297-21716715 Length = 767 Score = 28.3 bits (60), Expect = 8.3 Identities = 15/31 (48%), Positives = 20/31 (64%), Gaps = 3/31 (9%) Frame = +1 Query: 337 NESAN---ARGEAVCVLGALPLPRSLTRCAR 420 +ESAN AR EAV +G +P+ L RC+R Sbjct: 434 DESANVDAARSEAVMRVGGIPMLLDLARCSR 464 >07_03_0890 - 22332768-22333382 Length = 204 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP PPPPP Sbjct: 84 PPPPPPPPPPERAVPEAADTPPPPPPP 110 >04_03_1022 - 21778315-21779007 Length = 230 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP + P L PPPPP Sbjct: 18 PPPPATRARPPCSSAHLLPPPPPPPPP 44 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP PPPPP Sbjct: 356 PPPPPPPPPPPVYYSSYVMLDRPPPPP 382 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPPP PP + PPPPP Sbjct: 357 PPPPPPPPPPVYYSSYVMLDRPPPPPP 383 >03_02_0786 - 11169820-11170158,11170245-11170433,11171173-11171469, 11171568-11171630,11171884-11171997,11173011-11173091, 11173176-11173307,11174265-11174363,11174453-11174530, 11174641-11174901 Length = 550 Score = 28.3 bits (60), Expect = 8.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 712 PPPPGKKXPPXXXXXPLXXXXXPPPPP 792 PPP G PP P+ PPPP Sbjct: 31 PPPMGPPPPPPMPPVPVMYLRGVPPPP 57 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,697,197 Number of Sequences: 37544 Number of extensions: 331055 Number of successful extensions: 3964 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3066 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -