BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N04 (915 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 46 4e-05 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 42 5e-04 12_02_1174 - 26696869-26698191 40 0.003 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 38 0.011 03_01_0515 - 3864796-3865425 38 0.011 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 37 0.019 08_01_0059 - 394001-394708 37 0.026 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 37 0.026 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 36 0.045 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 36 0.059 12_02_0299 - 17051570-17052474,17053542-17053755 35 0.078 09_02_0543 + 10427321-10428315,10428440-10429154 35 0.10 01_06_1377 + 36764461-36765339 35 0.10 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 34 0.18 07_01_0080 + 587674-588510 34 0.18 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 34 0.18 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 33 0.24 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 33 0.24 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 33 0.24 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 33 0.24 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 33 0.24 01_01_0082 + 625198-625719 33 0.24 06_01_0486 - 3455030-3455770 33 0.32 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 33 0.32 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 33 0.32 11_06_0610 - 25449085-25453284 33 0.42 05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 33 0.42 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 33 0.42 12_02_1007 - 25248653-25249078,25249956-25250021,25250108-252502... 32 0.55 11_01_0385 + 2915532-2916482 32 0.55 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 32 0.55 08_02_1615 + 28257275-28258428,28258523-28259144 32 0.55 02_05_0149 + 26290236-26290880 32 0.55 01_01_0070 - 542603-542686,542803-543441 32 0.55 06_02_0175 - 12624608-12625297 32 0.73 05_03_0458 + 14280953-14281866,14281964-14282912 32 0.73 03_02_0765 + 11000724-11002496 32 0.73 01_01_0929 - 7344911-7345978 32 0.73 07_03_1751 - 29215074-29216270 31 0.97 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 31 0.97 07_03_0560 + 19479597-19480667 31 0.97 07_01_0516 - 3850252-3852870 31 0.97 06_03_1310 + 29238644-29240260 31 0.97 06_03_0757 + 24267599-24268882 31 0.97 06_03_0696 + 23617687-23617851,23618838-23619536 31 0.97 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 31 0.97 04_01_0034 - 401208-402923 31 0.97 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 31 0.97 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 31 0.97 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 0.97 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 31 0.97 11_01_0066 - 536281-537196,537397-537452 31 1.3 07_03_0558 + 19461369-19462448 31 1.3 04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 31 1.3 04_04_1125 + 31085106-31085714 31 1.3 03_01_0023 + 198414-198968 31 1.3 02_05_1277 - 35408097-35409080 31 1.3 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 31 1.3 01_01_0715 - 5542648-5543219,5543352-5543544 31 1.3 01_01_0570 - 4231100-4232560 31 1.3 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 31 1.7 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.7 07_03_0559 + 19475893-19476783 31 1.7 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 31 1.7 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 31 1.7 01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 31 1.7 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 30 2.2 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 30 2.2 07_03_0177 - 14770777-14772045 30 2.2 07_01_0479 + 3606663-3607448 30 2.2 05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149,275... 30 2.2 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 30 2.2 04_03_1022 - 21778315-21779007 30 2.2 02_04_0005 - 18843061-18843201,18843309-18843440,18844457-188453... 30 2.2 01_05_0490 + 22672241-22674679 30 2.2 12_02_0118 - 13869237-13869307,13869375-13869465,13870321-138704... 30 2.9 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 30 2.9 08_02_1329 - 26182762-26183007,26183149-26183249,26183533-261836... 30 2.9 08_02_0672 - 19904353-19904839,19905646-19905704,19906137-199063... 30 2.9 07_01_0862 - 7172083-7172931 30 2.9 05_06_0281 + 26912419-26913099 30 2.9 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 30 2.9 04_03_0904 + 20717005-20718087 30 2.9 04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 30 2.9 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 30 2.9 03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655,904... 30 2.9 02_04_0021 + 18975992-18976408 30 2.9 02_03_0120 + 15463163-15465250 30 2.9 02_02_0444 + 10340927-10341063,10341157-10341241,10341480-103415... 30 2.9 01_01_0482 + 3535083-3535194,3535301-3535467 30 2.9 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 29 3.9 07_01_0682 - 5141194-5141251,5141526-5141839 29 3.9 06_03_0790 - 24636805-24637770 29 3.9 06_03_0447 + 20878444-20878821 29 3.9 06_01_0383 - 2749030-2750160,2752418-2752488,2753470-2753791 29 3.9 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 29 3.9 03_05_0690 + 26778567-26778804,26778950-26779024,26779995-267800... 29 3.9 02_04_0400 - 22608519-22608844,22609044-22609122 29 3.9 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 29 3.9 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 29 3.9 10_08_1008 - 22222051-22222377,22222479-22222640,22223179-222233... 29 5.2 10_08_0214 - 15915156-15915713 29 5.2 09_02_0403 + 8590195-8590443,8590583-8590690,8590788-8590901,859... 29 5.2 06_03_0395 - 20354713-20355570 29 5.2 06_01_0178 + 1386981-1387505 29 5.2 03_05_0630 + 26260159-26260272,26260520-26260894 29 5.2 03_05_0292 + 22846273-22846377,22847161-22847823 29 5.2 03_05_0153 + 21299150-21299593,21299733-21299873,21299971-213000... 29 5.2 03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 29 5.2 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 29 6.8 10_08_0683 - 19860777-19861070,19861677-19861874,19862498-198626... 29 6.8 10_03_0023 - 7151465-7152111,7152222-7152405 29 6.8 09_01_0037 - 604001-604957 29 6.8 08_02_1455 + 27230134-27231110,27231195-27231327,27231417-272315... 29 6.8 07_03_1433 + 26513728-26514135,26525534-26526280 29 6.8 07_03_1432 - 26508135-26508881,26509301-26509708 29 6.8 07_03_0890 - 22332768-22333382 29 6.8 07_03_0600 + 19866757-19867218,19867920-19868429 29 6.8 06_03_1006 + 26844161-26844198,26844304-26844372,26844526-268445... 29 6.8 05_07_0162 + 28090579-28091343 29 6.8 03_02_0738 - 10824121-10825572 29 6.8 01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831,768... 29 6.8 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 29 6.8 12_02_0848 + 23636478-23638058 28 9.0 11_04_0009 - 12132781-12133272 28 9.0 10_08_0520 - 18495118-18498237 28 9.0 10_07_0188 + 13921731-13921938,13922076-13922338,13922463-13923257 28 9.0 09_02_0369 - 8012470-8013120 28 9.0 08_02_1084 - 24232968-24234779 28 9.0 08_02_0758 + 20848078-20849579,20849660-20849850,20849944-208501... 28 9.0 08_01_0134 + 1067826-1068158 28 9.0 06_03_1368 - 29612463-29612638,29613135-29613222,29613334-296134... 28 9.0 06_03_1326 - 29355467-29355817 28 9.0 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 28 9.0 05_07_0100 + 27679280-27680320 28 9.0 04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 28 9.0 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 28 9.0 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 28 9.0 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 28 9.0 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 46.0 bits (104), Expect = 4e-05 Identities = 22/61 (36%), Positives = 24/61 (39%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P+ PP + P A P PPP G PP PAK PPP P PP Sbjct: 311 PAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Query: 853 G 855 G Sbjct: 371 G 371 Score = 41.1 bits (92), Expect = 0.001 Identities = 20/56 (35%), Positives = 20/56 (35%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 A P PPP PP P K PPP P PP G S PP P Sbjct: 325 APPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGKKGGPPPP 380 Score = 37.1 bits (82), Expect = 0.019 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P PP P K PPP P PP G S PPP Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPP 369 Score = 35.9 bits (79), Expect = 0.045 Identities = 23/86 (26%), Positives = 25/86 (29%) Frame = +1 Query: 646 PXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPX 825 P P PS P + A PPP PP PA PPP P Sbjct: 277 PAARPASPSPSLPLPPGRESPSRPQSIAAAAVASPAPPPP---PPPKPAAAAPPPPPPPK 333 Query: 826 PXXXPPXXGGSXXTXFSSXSXXXPPP 903 PP G + PPP Sbjct: 334 AAPPPPPPKGPPPPPPAKGPPPPPPP 359 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/59 (32%), Positives = 19/59 (32%), Gaps = 3/59 (5%) Frame = +1 Query: 742 AXXPXPPPX---GTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 A P PPP PP P PPP P PP G PPP P Sbjct: 312 APPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPP 370 Score = 31.5 bits (68), Expect = 0.97 Identities = 23/80 (28%), Positives = 24/80 (30%), Gaps = 4/80 (5%) Frame = +2 Query: 683 PPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQK--PXXPPXXXPXPLXXPPXXG- 853 PPP P P P P+ P P K P PP P P PP G Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGK 373 Query: 854 -XAXXPGFPXXXXXXPPXXP 910 P P PP P Sbjct: 374 KGGPPPPPPKGGASRPPAAP 393 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/74 (25%), Positives = 22/74 (29%), Gaps = 2/74 (2%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPP--P 816 PP P + PP + G P PP PP P+ PP Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPPPPPGGK 373 Query: 817 XPXPXXXPPXXGGS 858 P PP G S Sbjct: 374 KGGPPPPPPKGGAS 387 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/69 (28%), Positives = 25/69 (36%), Gaps = 3/69 (4%) Frame = +2 Query: 494 KSIKYFVLNSXXXPXXPPPXPXXXXXXPPXPXXXS---PGXRGXPFFXGVSWXPPXXXXP 664 +SI + S P PPP P PP P + P +G P + PP P Sbjct: 301 QSIAAAAVASPAPPPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPP-PPPPAKGPPPPPPP 359 Query: 665 XAXXXXPPP 691 PPP Sbjct: 360 KGPSPPPPP 368 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 42.3 bits (95), Expect = 5e-04 Identities = 21/58 (36%), Positives = 24/58 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P A P PPP PP K PPP P P PP + ++S PPP P Sbjct: 539 PTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPL----PQSNYASSQPPPPPPPP 592 Score = 42.3 bits (95), Expect = 5e-04 Identities = 32/128 (25%), Positives = 38/128 (29%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P +R PP P+ PP Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPPPSLP--NRLVPPPPAPGIGNKFPAPPPPPPPPRSS 675 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 + P PPP PP PA P P PP + S+ + Sbjct: 676 SRTPTGAATSSKGPPPPPP--PPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAPAPP 733 Query: 892 XPPPXPXA 915 PPP P A Sbjct: 734 LPPPLPAA 741 Score = 36.3 bits (80), Expect = 0.034 Identities = 32/130 (24%), Positives = 36/130 (27%), Gaps = 6/130 (4%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P + PP P P+ P Sbjct: 549 PPPPPPSGNKPAFSPPPPPPP-PPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPP 607 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP------XXXPPXXGGSXXTXF 873 P P PPP PP P + PPP P P PP F Sbjct: 608 PPPIL---PNRSVPPPPP--PPPPLPNHSVLPPPPPPPPPPSLPNRLVPPPPAPGIGNKF 662 Query: 874 SSXSXXXPPP 903 + PPP Sbjct: 663 PAPPPPPPPP 672 Score = 33.9 bits (74), Expect = 0.18 Identities = 21/88 (23%), Positives = 24/88 (27%) Frame = +1 Query: 646 PXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPX 825 P P P PP F P P PPP ++ PPP P Sbjct: 535 PSPSPTAAAPPPPPPPPPPPSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPL 594 Query: 826 PXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P + PPP P Sbjct: 595 PNCLVPSPPPPPPPPPILPNRSVPPPPP 622 Score = 32.3 bits (70), Expect = 0.55 Identities = 31/131 (23%), Positives = 34/131 (25%) Frame = +2 Query: 518 NSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXS 697 N P PPP P P P P P + PP PPP Sbjct: 614 NRSVPPPPPPPPPLPNHSVLPPPPPPPP-PPSLP--NRLVPPPPAPGIGNKFPAPPPPPP 670 Query: 698 XVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFP 877 P P P P PL P + P P PP + P P Sbjct: 671 PPRSSSRTPTGAATSSKGPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPPANRSNGPSAP 730 Query: 878 XXXXXXPPXXP 910 PP P Sbjct: 731 --APPLPPPLP 739 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/89 (23%), Positives = 21/89 (23%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P P PP Q P P PP P PP P Sbjct: 554 PSGNKPAFSPPPPPPPPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPPPPPPPPPILP 613 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP S PPP P Sbjct: 614 NRSVPPPPPPPPPLPNHSVLPPPPPPPPP 642 Score = 29.5 bits (63), Expect = 3.9 Identities = 35/146 (23%), Positives = 37/146 (25%), Gaps = 16/146 (10%) Frame = +2 Query: 521 SXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXP--------XAXX 676 S P PPP P P P P P S PP P Sbjct: 582 SSQPPPPPPPPPLPNCLVPSPPPPPPP----PPILPNRSVPPPPPPPPPLPNHSVLPPPP 637 Query: 677 XXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQK--------PXXPPXXXPXPL 832 PPP S P + P P P P + PP P PL Sbjct: 638 PPPPPPSLPNRLVPPPPAPGIGNKFPAPPPPPPPPRSSSRTPTGAATSSKGPPPPPPPPL 697 Query: 833 XXPPXXGXAXXPGFPXXXXXXPPXXP 910 P PG P PP P Sbjct: 698 ---PPANRTNGPGVPSAPPPPPPPPP 720 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP K PPP P PP Sbjct: 748 PAPPP---PPLMTGKKAPAPPPPPPQAPKPP 775 >12_02_1174 - 26696869-26698191 Length = 440 Score = 39.9 bits (89), Expect = 0.003 Identities = 34/126 (26%), Positives = 35/126 (27%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P PP P PS PP + Sbjct: 155 PPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPP---PPTRPPSVKPPVV-QPKP 210 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 Q P P PPP PP P T P P P PP Sbjct: 211 QPPPTLPPPS---PPPPPPTVPPRTPGDTPAVVEPKPQPPPPPPRAPVKMPRVL-EPKPS 266 Query: 892 XPPPXP 909 PPP P Sbjct: 267 PPPPSP 272 Score = 39.5 bits (88), Expect = 0.004 Identities = 31/126 (24%), Positives = 35/126 (27%), Gaps = 3/126 (2%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXX---PXXXXPSXXPPXXXRXXX 711 PPP P P P P R + P P PS PP Sbjct: 223 PPPPTVPPRTPGDTPAVVEPKPQPPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPPEDYWS 282 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 P P PP PP P++ PPP P P G + S Sbjct: 283 PTAVTPPEPTKPKPPPPSPPPPPQQPSQRYWTPPPAITPEPAKPAAGKPTSSSPPSTKDS 342 Query: 892 XPPPXP 909 PP P Sbjct: 343 PRPPLP 348 Score = 31.5 bits (68), Expect = 0.97 Identities = 23/89 (25%), Positives = 24/89 (26%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P P PP R + P PP PP P PPP P Sbjct: 111 PEFKTPPALSPVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPP-----PPPPPP 165 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P S PPP P Sbjct: 166 RPPSVKPPVVQPKPQPPPSLQPPSPPPPP 194 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/106 (25%), Positives = 27/106 (25%), Gaps = 2/106 (1%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXP--PPXSXVX 706 P PPP P PP P P P PP P P PP Sbjct: 150 PSLPPPPPPPPPPPPPRPPSVKP-----PVVQPKPQPPPSLQPPSPPPPPPTRPPSVKPP 204 Query: 707 XXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPP 844 P P P P P P P P P PP Sbjct: 205 VVQPKPQPPPTL-PPPSPPPPPPTVPPRTPGDTPAVVEPKPQPPPP 249 Score = 29.5 bits (63), Expect = 3.9 Identities = 17/67 (25%), Positives = 19/67 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP + P PP PP P + PP Sbjct: 148 PPPSLPPPPPPPPPPPPPRPPSVKPPVVQPKPQPPPSLQPP-SPPPPPPTRPPSVKPPVV 206 Query: 823 XPXXXPP 843 P PP Sbjct: 207 QPKPQPP 213 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/51 (35%), Positives = 20/51 (39%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PPP TPP P PPP P P + + S S PPP P Sbjct: 73 PPPPQTPPSPPPPPPPPPPPPPPLSPTPTTTSWTTNSSSISASPILPPPPP 123 >03_01_0515 - 3864796-3865425 Length = 209 Score = 37.9 bits (84), Expect = 0.011 Identities = 25/100 (25%), Positives = 26/100 (26%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 T P P P P P PP P P P Sbjct: 25 TTAAPAPSPEAEASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPP 84 Query: 709 XQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P A P PPP PP P K+ PPP P Sbjct: 85 PPPLPPPPPPPAASPPPPPPSPPPPSPVKSSPPPPPAWSP 124 Score = 35.1 bits (77), Expect = 0.078 Identities = 20/61 (32%), Positives = 23/61 (37%), Gaps = 3/61 (4%) Frame = +1 Query: 742 AXXPXPPPXGTPPXX---PAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPX 912 A P PP +PP P+ T PPP P PP S + PPP P Sbjct: 37 ASPPSPPTEASPPPLAPPPSVTSSPPPPAAGPLMPPPPPPPSVTSSPPPPPLPPPPPPPA 96 Query: 913 A 915 A Sbjct: 97 A 97 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P S PP P + PPP PP P PPP P Sbjct: 48 PPPLAPPPSVTSSPPPPAAGPLMPPPP---PPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Query: 823 XPXXXPP 843 P P Sbjct: 105 SPPPPSP 111 Score = 32.7 bits (71), Expect = 0.42 Identities = 21/58 (36%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGT--PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PPP T PP P PPP P P PP S S PPP Sbjct: 68 PLMPPPPPPPSVTSSPPPPPL-----PPPPPPPAASPPPPPPSPPPPSPVKSSPPPPP 120 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXT 867 P P PPP P P + PPP P PP S T Sbjct: 85 PPPLPPPPPPPAASPPPPPPS--PPPPSPVKSSPPPPPAWSPVT 126 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 37.1 bits (82), Expect = 0.019 Identities = 20/52 (38%), Positives = 20/52 (38%) Frame = +1 Query: 685 PPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 PP R Q P A P PPP PP PA PPP P P P Sbjct: 111 PPPPPRKKPQFQPPPQPPRAWDPSPPP---PPPAPAAPVLVPPPAPAPRPAP 159 >08_01_0059 - 394001-394708 Length = 235 Score = 36.7 bits (81), Expect = 0.026 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG--GSXXTXFSSXSXXXPPPXP 909 P P PPP PP PPP P P PP S + PPP P Sbjct: 12 PPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPPSP 71 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/68 (26%), Positives = 19/68 (27%), Gaps = 1/68 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPP-PX 819 PP P PP P P PP + P P PP P Sbjct: 6 PPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPV 65 Query: 820 PXPXXXPP 843 P P PP Sbjct: 66 PPPPSPPP 73 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/56 (32%), Positives = 18/56 (32%), Gaps = 3/56 (5%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXP---PPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP P PA P PP P P PP S PP P Sbjct: 2 PPPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 36.7 bits (81), Expect = 0.026 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 2/62 (3%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPP--XXPAKTXXXPPPXPXPXXXPPX 846 P PP G P P PPP G PP P +T PPP P P P Sbjct: 228 PLPPPPPPPPKPANIAGAPGLPLPPPP-PPPPGPPPREIVPGQTLLPPPPPPRPLQPSPL 286 Query: 847 XG 852 G Sbjct: 287 AG 288 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/56 (32%), Positives = 19/56 (33%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 A P PP PP PA P P P PP G + PPP P Sbjct: 224 ASLPPLPPPPPPPPKPANIAGAPG-LPLPPPPPPPPGPPPREIVPGQTLLPPPPPP 278 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 PPP G PP PP P P PP G Sbjct: 407 PPPPGLPPAQMQMAPFGVPPGPPPMLPPPFYPG 439 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/59 (27%), Positives = 19/59 (32%), Gaps = 1/59 (1%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXP-PPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P + P P+ P PP P P P G+ P P P Sbjct: 204 PPPPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/57 (28%), Positives = 16/57 (28%) Frame = +1 Query: 673 PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PP P P PPP A PPP P P PP Sbjct: 206 PPPPPPLPASSEPVDPSAASLPPLPPPPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 G P P PPP PP P P P P P Sbjct: 378 GVPRFPPPPPPPDTRPPFMAPGVNARPLPPPPPGLPP 414 Score = 28.3 bits (60), Expect = 9.0 Identities = 26/101 (25%), Positives = 28/101 (27%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P P + GV PP PPP + G Sbjct: 350 PPPQPSHLPPLPPRPPTM-PSMQPDMLAPGVPRFPPPP---------PPPDTRPPFMAPG 399 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPP 844 L PG P P PP P P P Sbjct: 400 VNARPLPPPPPGLPPAQMQMAPFGVPPGPPPMLPPPFYPGP 440 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 35.9 bits (79), Expect = 0.045 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P PPP P P P + PPP P Sbjct: 1162 PSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVP 1214 Score = 35.5 bits (78), Expect = 0.059 Identities = 25/91 (27%), Positives = 26/91 (28%), Gaps = 2/91 (2%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPP--PXGTPPXXPAKTXXXPPP 816 PP P PP P P PP P TPP P + PPP Sbjct: 1123 PPLPDGPPPLPLDAPPPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPP 1182 Query: 817 XPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP G PPP P Sbjct: 1183 PP----PPPLPSGPPPQPAPPPLPIQPPPIP 1209 Score = 33.9 bits (74), Expect = 0.18 Identities = 29/104 (27%), Positives = 30/104 (28%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PPP P PP P P P PP P PPP Sbjct: 1126 PDGPPPLPLDAPPPPPLPEGPPPLPSDSP-----PCQPPLPPSPPPATPPPPP------- 1173 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPP 844 P L P P P P P Q P P P+ PP Sbjct: 1174 ---PLSPSL--PPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPP 1212 Score = 32.3 bits (70), Expect = 0.55 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PP PP P+ P P P P PP + SS P P Sbjct: 1172 PPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAP 1227 Score = 31.1 bits (67), Expect = 1.3 Identities = 26/94 (27%), Positives = 27/94 (28%), Gaps = 5/94 (5%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGT-----PPXXPAKTXXX 807 PP PS PP Q P A P PPP PP P + Sbjct: 1140 PPLPEGPPPLPSDSPPC------QPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPP 1193 Query: 808 PPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P P S S PP P Sbjct: 1194 PQPAPPPLPIQPPPIPPPPVPSSPSSLGYQPPAP 1227 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 L S P PP P PP P SP P + PP P PPP Sbjct: 1149 LPSDSPPCQPPLPPSPPPATPPPPPPLSPSLPPPPPPPPLPSGPPPQPAPPPLPIQPPP 1207 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 35.5 bits (78), Expect = 0.059 Identities = 19/53 (35%), Positives = 20/53 (37%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 PGP P+ P KP PP P P PP G PG P P P Sbjct: 183 PGPKPKPPKPGPKPKPK-PPKPGPKPKPKPPKPGPKPKPGPPQPWWPIPFPKP 234 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/54 (31%), Positives = 18/54 (33%), Gaps = 1/54 (1%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXX-PXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 PGP P+ P KP P P P PP G P P P P Sbjct: 159 PGPKPKPKPSPPKPKPGPKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPP 212 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 PGP P+ P KP PP P P PP G P P P P Sbjct: 174 PGPKPKPP--KPGPKPK-PPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPP 223 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 1/40 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPP-PXPXPXXXPPXXG 852 P P P P PP K PP P P P PP G Sbjct: 176 PKPKPPKPGPKPKPPKPGPKPKPKPPKPGPKPKPKPPKPG 215 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPP-PXPXPXXXPP 843 P P P P PP K PP P P P PP Sbjct: 187 PKPPKPGPKPKPKPPKPGPKPKPKPPKPGPKPKPGPP 223 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 35.1 bits (77), Expect = 0.078 Identities = 33/128 (25%), Positives = 37/128 (28%), Gaps = 2/128 (1%) Frame = +1 Query: 520 FXXTPXXPPPXXXXPXXXXXX-PXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXX 696 F P PPP P P FP P+FS PP P P P Sbjct: 249 FLTPPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPS-PPPPPPPAFPFPFPQLPPL 307 Query: 697 XRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP-XPXPXXXPPXXGGSXXTXF 873 + P P PPP PP P P P P P + + Sbjct: 308 PHFPPLPSFYPSPPP---PPPPPPPPPPSFPWPFPPLAPLFPPYPSPPPSMYSRKDPSTW 364 Query: 874 SSXSXXXP 897 SS S P Sbjct: 365 SSSSKQQP 372 Score = 31.9 bits (69), Expect = 0.73 Identities = 20/59 (33%), Positives = 20/59 (33%), Gaps = 1/59 (1%) Frame = +1 Query: 736 PXAXXPXPP-PXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP P TPP P P P P P PP S PPP P Sbjct: 238 PFLPFPLPPIPFLTPPSPPPPAFPFPLP-PWPWAPPPAFPFPHLPPIFSPPSPPPPPPP 295 Score = 29.1 bits (62), Expect = 5.2 Identities = 23/94 (24%), Positives = 27/94 (28%), Gaps = 4/94 (4%) Frame = +2 Query: 632 VSWXPPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPP 811 + + P P PPP + P P P P A P P PP Sbjct: 217 IPFCTPRPWFPPIPFLTPPPPPFLPF----PLPPIPFLTPPSPPPPAFPFPLPPWPWAPP 272 Query: 812 XXXP----XPLXXPPXXGXAXXPGFPXXXXXXPP 901 P P+ PP P FP PP Sbjct: 273 PAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPP 306 Score = 25.4 bits (53), Expect(2) = 7.9 Identities = 20/77 (25%), Positives = 20/77 (25%), Gaps = 2/77 (2%) Frame = +3 Query: 687 PPXPPXXXTXXXLXRXXSGGGPXAPXXGHPSX--PXXKNPXXPPXXXXSXXXSPPXGGXX 860 PP PP L P P P P P PP PP Sbjct: 252 PPSPPPPAFPFPLPPWPWAPPPAFPFPHLPPIFSPPSPPPPPPPAFPFPFPQLPPLPHFP 311 Query: 861 XXXVFLXLXXXPPPXPP 911 F PPP PP Sbjct: 312 PLPSFYPSPPPPPPPPP 328 Score = 21.4 bits (43), Expect(2) = 7.9 Identities = 8/18 (44%), Positives = 8/18 (44%) Frame = +3 Query: 546 PXXPPXXXXXXPPPXXLP 599 P PP PPP LP Sbjct: 224 PWFPPIPFLTPPPPPFLP 241 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/58 (29%), Positives = 19/58 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P TPP ++ PPP P PP PPP P Sbjct: 13 PAPPRPTPAPQATPPPAIPESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGP 70 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/62 (30%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +1 Query: 736 PXAXXPXPPPXGTP---PXXPAKTXXXPPPXPXPXXXP-PXXGGSXXTXFSSXSXXXPPP 903 P P PPP P P P PPP P P P P + + + PPP Sbjct: 39 PAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPGPAAAPSPHSPSPSNAPWVAPAADIPPP 98 Query: 904 XP 909 P Sbjct: 99 PP 100 Score = 30.3 bits (65), Expect = 2.2 Identities = 23/89 (25%), Positives = 26/89 (29%) Frame = +2 Query: 578 PXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPG 757 P P +P + P PP P A PPP + P PG Sbjct: 13 PAPPRPTPAPQATPPPAIPESGPPP---PPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPG 69 Query: 758 PXPRAPLXPXXQKPXXPPXXXPXPLXXPP 844 P P A P P P P PP Sbjct: 70 PGPAAAPSPHSPSPSNAPWVAPAADIPPP 98 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPP-PXPXPXXXPPXXGG 855 P + P PP PP P P P P P PP G Sbjct: 31 PESGPPPPPAPDMPPPPPTPAPQSSPAPPPAPDMTPPPGPG 71 >01_06_1377 + 36764461-36765339 Length = 292 Score = 34.7 bits (76), Expect = 0.10 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP PP + PPP P PP GS S PPP P Sbjct: 155 PPPPEPQYPPPSSSPYYFPPPPPPAYSAPPPPQYGSEQYYRSGGYYSAPPPPP 207 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 33.9 bits (74), Expect = 0.18 Identities = 34/128 (26%), Positives = 38/128 (29%), Gaps = 2/128 (1%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P P P P PP P +P P PP P PPP Sbjct: 6 PYAPHPPPPQGGF-PPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPP------P 58 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXG--XAXXPGFPXXX 886 GP + GP P P Q+P PP P PP G + P P Sbjct: 59 PPGPPPPHQPQFNFGPGP-----PQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPP 113 Query: 887 XXXPPXXP 910 PP P Sbjct: 114 PSPPPSAP 121 Score = 33.9 bits (74), Expect = 0.18 Identities = 19/60 (31%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP--XXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P A P PP G PP P PPP P PP G PP P Sbjct: 6 PYAPHPPPPQGGFPPQPPPMNPYGPPPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 Score = 33.5 bits (73), Expect = 0.24 Identities = 30/116 (25%), Positives = 31/116 (26%), Gaps = 12/116 (10%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PP P P G P FL PP P P P Sbjct: 20 PQPPPMNPYGPPPPQQPAYGHMPPPQGAP---PPFLAPPPPPPPGPPPPHQPQFNFGPGP 76 Query: 712 QXXXFXGXPXAXX----PXPPPXGT--------PPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP G PP P+ PPP P P PP Sbjct: 77 PQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPPPPPPTQPP 132 Score = 32.7 bits (71), Expect = 0.42 Identities = 30/111 (27%), Positives = 31/111 (27%), Gaps = 2/111 (1%) Frame = +2 Query: 542 PPPX--PXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXX 715 PPP P PP P P F G PP P PPP Sbjct: 42 PPPQGAPPPFLAPPPPPPPGPPPPHQPQFNFGPG--PPQQQQP------PPPPQMYYQPP 93 Query: 716 XGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXP 868 P + P P P P P P PP P P PP P Sbjct: 94 PPPPPYGVNSSQPPPPPPPPPSPP---PSAPPPPPPPPTQPPPREAQLAPP 141 Score = 32.3 bits (70), Expect = 0.55 Identities = 25/98 (25%), Positives = 28/98 (28%) Frame = +1 Query: 520 FXXTPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXX 699 F P PPP P P P + + PP P S PP Sbjct: 51 FLAPPPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYYQPPPPPPPYGVNSSQPPPPP 110 Query: 700 RXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPP 813 P A P PPP PP A+ PP Sbjct: 111 PPPPSPP-----PSAPPPPPPPPTQPPPREAQLAPPPP 143 >07_01_0080 + 587674-588510 Length = 278 Score = 33.9 bits (74), Expect = 0.18 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PP G+PP P PPP P P Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPPPP 121 Score = 31.5 bits (68), Expect = 0.97 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP PP PPP P P PP Sbjct: 91 PPPPPPPPPSSGSPPPPPPPPPPPPPPPP 119 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 33.9 bits (74), Expect = 0.18 Identities = 18/58 (31%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP P P + PPP P PP S + PPP P Sbjct: 65 PTVTTPTPPPPPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISP--TPAPPLPPPPAP 120 Score = 31.5 bits (68), Expect = 0.97 Identities = 25/88 (28%), Positives = 28/88 (31%), Gaps = 1/88 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXP-PPX 819 PP P P+ PP + P PP TPP PA P PP Sbjct: 60 PPLPTPTVTTPTPPPPPPAPRPPRRHH-----RIPPPPPPLLPTPPPPPASISPTPAPPL 114 Query: 820 PXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P + F S S PP Sbjct: 115 PPPPAPAPPP--TPTPKFPSSSANPSPP 140 Score = 30.3 bits (65), Expect = 2.2 Identities = 17/55 (30%), Positives = 17/55 (30%), Gaps = 2/55 (3%) Frame = +2 Query: 752 PGPXPRAPLXPXXQK--PXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P P AP P P PP P P P P P PP P Sbjct: 72 PPPPPPAPRPPRRHHRIPPPPPPLLPTPPPPPASISPTPAPPLPPPPAPAPPPTP 126 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P PP PP P K PPP P P P G Sbjct: 618 PRPPGAPPPPPPPGKPGGPPPPPPRPGSLPRNLAG 652 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P PP PP P K PPP P P P G Sbjct: 923 PRPPGAPPPPPPPGKPGGPPPPPPPPGSLPRNLAG 957 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 33.5 bits (73), Expect = 0.24 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 G A P PPP +P PA PP P P PP Sbjct: 215 GPKGAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPPPP 252 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 33.5 bits (73), Expect = 0.24 Identities = 20/60 (33%), Positives = 22/60 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PPP +PP PA PPP P P SS + PP P A Sbjct: 578 PLKASPVPPPEPSPP--PAPKAAPPPPPPKSTGPGPPRPPPPAMPGSSKTRPPPPLKPGA 635 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/51 (33%), Positives = 19/51 (37%) Frame = +2 Query: 758 PXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P+AP+ P P PP P PP A P P PP P Sbjct: 570 PAPQAPMPPLKASPVPPPEPSP-----PPAPKAAPPPPPPKSTGPGPPRPP 615 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 PP P P K PPP P P P + PPP Sbjct: 569 PPAPQAPMPPLKASPVPPPEPSPPPAPKAAPPPPPPKSTGPGPPRPPP 616 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP T PPP P P P Sbjct: 349 PPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP P P P P PP Sbjct: 345 PSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPP 380 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 A P PPP PP P P P P PP Sbjct: 348 APPPPPPPPPPPPPPPPPKLNTAPKPPPPPPPPP 381 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/51 (35%), Positives = 19/51 (37%) Frame = +2 Query: 758 PXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P PR P+ P P PP P P PP A P P PP P Sbjct: 338 PSPR-PVQPSNAPPPPPPPPPPPPPPPPPKLNTAPKPPPP---PPPPPSVP 384 >01_01_0082 + 625198-625719 Length = 173 Score = 33.5 bits (73), Expect = 0.24 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P PPP PP P PP P PP GG Sbjct: 66 PPPPPVYYPPPSPPPVAYPPPTTPSTNCPPPPYGG 100 >06_01_0486 - 3455030-3455770 Length = 246 Score = 33.1 bits (72), Expect = 0.32 Identities = 18/58 (31%), Positives = 20/58 (34%), Gaps = 2/58 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPP--PXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P P P TPP P+ PP P P P PP + PPP Sbjct: 77 PPYTPPTPRPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPPTPPYVPPPTPPSPPP 134 Score = 31.5 bits (68), Expect = 0.97 Identities = 25/92 (27%), Positives = 27/92 (29%), Gaps = 2/92 (2%) Frame = +1 Query: 646 PXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPP--PXGTPPXXPAKTXXXPPPX 819 P P P+ PP + P P PP P PP P PP Sbjct: 73 PSCHPPYTPPTPRPPPTPPYVPSPPPYV-PPYIPPPTPPYVPPYIPPPTPPYVPPPTPPS 131 Query: 820 PXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PP S PPP P A Sbjct: 132 PPPYVPPPTP--------PSPPPYVPPPSPPA 155 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PPP PP P PPP P P Sbjct: 349 PKLMPPPPPPPPPPPPPPPPPPPRPPPPPPP 379 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P PPP P PP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPP 386 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P PPP PP P PPP P Sbjct: 361 PPPPPPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P PPP PP P K PP P Sbjct: 362 PPPPPPPPPPRPPPPPPPIKKGAPPPAPP 390 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 2/53 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPP--XPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PPP PP P T PPP P P PP GS S+ P P Sbjct: 430 PPPPPEHPPP--PESTSPPPPPTSDPPPVPPPPPTTGSFMPIPSAPFAGLPVP 480 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 763 PXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP P+ PPP P PP S +S PPP P Sbjct: 415 PQSPPPPLPSDAFEQPPPPP--EHPPPPESTSPPPPPTSDPPPVPPPPP 461 Score = 28.7 bits (61), Expect = 6.8 Identities = 31/130 (23%), Positives = 33/130 (25%), Gaps = 4/130 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P S PP P P P Sbjct: 415 PQSPPPPLPSDAFEQPPPPPEHPP----PPESTSPPPPPTSDPPPVPPPP-PTTGSFMPI 469 Query: 712 QXXXFXGXPXAXXPXPP-PXGTPPXXPAKTXXX---PPPXPXPXXXPPXXGGSXXTXFSS 879 F G P P P + P P PPP P PP G + Sbjct: 470 PSAPFAGLPVPAGPMTAVPYNSYPVFPPMNYPMVNIPPPFPSAPNTPPGFQGLAGPFYGP 529 Query: 880 XSXXXPPPXP 909 PPP P Sbjct: 530 PYPAPPPPPP 539 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/67 (25%), Positives = 19/67 (28%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P P PP + P + PPP TP P PP P Sbjct: 877 PETKSPPTLTPEISPPPEGKSPPSHTPESSSPPSKESEPPPTPTPKSSPPSHEEYVPPSP 936 Query: 823 XPXXXPP 843 PP Sbjct: 937 AKSTPPP 943 Score = 31.5 bits (68), Expect = 0.97 Identities = 21/62 (33%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPP----PXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PPP G P P + PP P P P G S T S S PPP Sbjct: 542 PATPESSPPPEGKSPPTPTASHSPPPVPEGHTPSPPKSGPPAGESPPTPESKAS---PPP 598 Query: 904 XP 909 P Sbjct: 599 TP 600 Score = 30.7 bits (66), Expect = 1.7 Identities = 30/126 (23%), Positives = 34/126 (26%), Gaps = 1/126 (0%) Frame = +1 Query: 529 TPXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 +P P P P P P P+ PP P P + Sbjct: 726 SPPPPAPEGHTPSPPKSSP----PEEKSPPIPPTSHTSPPTPEEYTPSPPKSSPPEEKSP 781 Query: 709 XQXXXFXGXPXAXXPX-PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXS 885 P P PPP P PA+ PP P PP G T S Sbjct: 782 PPHSPEKSPPSEAHPTSPPPSEKSPPTPAE--ESSPPTPEKSPSPP--SGHEGTPPSPVK 837 Query: 886 XXXPPP 903 PPP Sbjct: 838 SSSPPP 843 Score = 30.3 bits (65), Expect = 2.2 Identities = 23/92 (25%), Positives = 25/92 (27%), Gaps = 1/92 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXX-FXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPX 819 PP P P PP + P P PP P P K+ PPP Sbjct: 1163 PPIKSPPPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPVKSP--PPPA 1220 Query: 820 PXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P PP S P P A Sbjct: 1221 PVILPPPPVKSPPPPAPVISPPPPEKSPPPAA 1252 Score = 29.9 bits (64), Expect = 2.9 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP + P A P PPP PA PPP P Sbjct: 1275 PPVKSLPPPAPVSLPPPVVKSLPPPAPVSLPPPAVKPLPPPAPVSLPPPA-VKPLPPPVP 1333 Query: 823 XPXXXPP 843 PP Sbjct: 1334 QVSLPPP 1340 Score = 29.5 bits (63), Expect = 3.9 Identities = 21/62 (33%), Positives = 23/62 (37%), Gaps = 9/62 (14%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPP---------PXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP G P P + PP P P PP G S T +S S PPP Sbjct: 511 PPPPSSGWLPKSPERKKAPPPQAEPPTEYSPPATPESSPPPEGKSPPTPTASHS---PPP 567 Query: 904 XP 909 P Sbjct: 568 VP 569 Score = 29.1 bits (62), Expect = 5.2 Identities = 25/104 (24%), Positives = 25/104 (24%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PP P P P P P P S PP Sbjct: 1135 PLPPPVPVSSPPPPEKSPPPPAPVILPPPPIKSPPPPAPVISPPPPVKSPPPPAPVILPP 1194 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P A PPP P PA PPP P P Sbjct: 1195 PPVKSP-PPPAPVISPPPPVKSPPPPAPVILPPPPVKSPPPPAP 1237 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/63 (31%), Positives = 22/63 (34%), Gaps = 5/63 (7%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPP-----XPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P PP +PP +K PPP P P P S T S S PP Sbjct: 605 PSPPKSTPPAEKSPPTPESKASSPPPPAPEGHTPSPPESTPPSEKSPPTPESKAS-SPPP 663 Query: 901 PXP 909 P P Sbjct: 664 PTP 666 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/67 (28%), Positives = 20/67 (29%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP + P A PPP P PA PPP Sbjct: 1195 PPVKSPPPPAPVISPPPPVKSPP--------PPAPVILPPPPVKSPPPPAPVISPPPPEK 1246 Query: 823 XPXXXPP 843 P P Sbjct: 1247 SPPPAAP 1253 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/67 (25%), Positives = 18/67 (26%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP + P PPP P PPP P Sbjct: 1211 PPVKSPPPPAPVILPPPPVKSPPPPAPVISPPPPEKS-PPPAAPVILSPPAVKSLPPPAP 1269 Query: 823 XPXXXPP 843 PP Sbjct: 1270 VSLPPPP 1276 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/67 (28%), Positives = 21/67 (31%), Gaps = 1/67 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTP-PXXPAKTXXXPPPX 819 PP P P PP + P A PPP P P K+ PPP Sbjct: 1227 PPVKSPPPPAPVISPPPPEKSPPPAAPVILSPPAVKSLPPPAPVSLPPPPVKS--LPPPA 1284 Query: 820 PXPXXXP 840 P P Sbjct: 1285 PVSLPPP 1291 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/53 (26%), Positives = 16/53 (30%) Frame = +1 Query: 685 PPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PP + P + PPP TP P PP P PP Sbjct: 941 PPPEEKSPPSHTPESSSPPSEESEPPPSPTPKSSPPSHEEYVPPSPAKSTPPP 993 >05_01_0492 - 4102379-4103494,4104105-4104383,4105395-4105724 Length = 574 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/52 (32%), Positives = 17/52 (32%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 PP PP PA PP P P PP S PP P A Sbjct: 261 PPPSHPPALPALPAPNAPPPPAPQSQPPSQFPGHLPHSQVQSVPPAPPTPLA 312 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 32.7 bits (71), Expect = 0.42 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P PPP PP P + PPP P PP S SS PP Sbjct: 36 PSPPP---PPPSPVPSPAPPPPPHRPSPSPPPNPLSSKLWLSSKLSPPPP 82 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P P P PP P + PPP P Sbjct: 38 PPPPPPSPVPSPAPPPPPHRPSPSPPPNP 66 >12_02_1007 - 25248653-25249078,25249956-25250021,25250108-25250260, 25250961-25251336,25252001-25252143 Length = 387 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP T P P PPP P PP Sbjct: 294 PPPPPPVTMPMHPGMVLAAPPPGAAPPPGPP 324 >11_01_0385 + 2915532-2916482 Length = 316 Score = 32.3 bits (70), Expect = 0.55 Identities = 33/122 (27%), Positives = 35/122 (28%), Gaps = 3/122 (2%) Frame = +2 Query: 545 PPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXP--PXXXXPXAXXXXPPPXSXVXXXXX 718 P P PP P P P G W P P P P P + Sbjct: 191 PEWPHPGNKWPPLPPFHPPPTPAWPHPGGNKWPPLPPFPSHPPPTPAWPQPGNK--WPPL 248 Query: 719 GPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXX-PXPLXXPPXXGXAXXPGFPXXXXXX 895 PF P P P P P Q P PP P P+ P G P P Sbjct: 249 PPFPSH-----PPPTPAWP-HPGNQWPPLPPFPFHPPPMPAWPHPGNQWPPLPPFHGSDV 302 Query: 896 PP 901 PP Sbjct: 303 PP 304 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 32.3 bits (70), Expect = 0.55 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P P PPP PP T PPP P P P Sbjct: 324 PSNPPPAPPPPPPPPSRFNNTTPKPPPPPPPPEPP 358 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 32.3 bits (70), Expect = 0.55 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P A PPP PP +T PPP P P Sbjct: 61 PPAPLTPPPPKSPPPPPHIQTTDLPPPKPLP 91 >02_05_0149 + 26290236-26290880 Length = 214 Score = 32.3 bits (70), Expect = 0.55 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G G G + F G GG P G G G G Sbjct: 103 GGGGGGGGGGSGRAYGFGGGYGGHPGGFGGGGGGGG 138 >01_01_0070 - 542603-542686,542803-543441 Length = 240 Score = 32.3 bits (70), Expect = 0.55 Identities = 18/67 (26%), Positives = 22/67 (32%) Frame = +2 Query: 644 PPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXP 823 PP P PP + P + P P +AP P P PP P Sbjct: 49 PPAPATPAPTATPTPPVAPAKAPPVAPAVAPVTPPPPTP-KKAPPPPVTPPPVTPPPVTP 107 Query: 824 XPLXXPP 844 P+ PP Sbjct: 108 PPVSPPP 114 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP TPP PP P P PP Sbjct: 84 PPTPKKAPPPPVTPPPVTPPPVTPPPVSPPPATPPP 119 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/60 (28%), Positives = 18/60 (30%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PP TPP P PP P PP + PPP A Sbjct: 94 PVTPPPVTPPPVTPP--PVSPPPATPPPALPPSTPPPVAAPAEAPAALPPATTPPPVAEA 151 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 A P PP TP P PP P P PP Sbjct: 76 AVAPVTPPPPTPKKAPPPPVTPPPVTPPPVTPPP 109 >06_02_0175 - 12624608-12625297 Length = 229 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G GGG V GG G G GG W + G GG G G Sbjct: 45 GGGGGNGTSYNATSVAGRKDGGGGGGGGGGSSGGSSWSYGWGWGWGTDSGGGGSSGGG 102 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 95 GGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 96 GGSSGGGGGGGGGGGGGGGGGGGGGGGGGGG 126 >05_03_0458 + 14280953-14281866,14281964-14282912 Length = 620 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP T P+ + PPP P PP T S S PPP P Sbjct: 46 PTVPPSLTTTSSPSSSPSSPPPLPPLQPTPPPL---PPTTLSCSSHPTPPPPP 95 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 5/40 (12%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKT-----XXXPPPXPXPXXXP 840 P + P PP TPP P T PPP P P P Sbjct: 62 PSSPPPLPPLQPTPPPLPPTTLSCSSHPTPPPPPSPTTSP 101 >03_02_0765 + 11000724-11002496 Length = 590 Score = 31.9 bits (69), Expect = 0.73 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVF-AGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG+ GGG G A G Sbjct: 100 GGFGGGLGHGGGLGGGFGGGKGGGLGGGGGLGGGAGG 136 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/36 (47%), Positives = 18/36 (50%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG AG GG+ GGG G A G Sbjct: 118 GGKGGGLGGGGGLGGG-AGGGGGLGSGGGLGGGAGG 152 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG AG GG GGG G A G Sbjct: 542 GGFGAGGGAGGGAG---AGFGGGAGAGGGGGLGAGG 574 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG GGG G G Sbjct: 62 GGFGGGLGHGGGLGGGFGGGKGG-GLGGGGGLGGGG 96 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 138 GGLGSGGGLGGGAG---GGLGGGAGGGGGLGGGAGG 170 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 280 GGGGLGGGTGGG-----GGLGGGTGGGGGLGGGAGG 310 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 400 GGLGGGAGTGGG-----GGLGGGAGGGGGLGGGAGG 430 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXA 741 GG G G GGG + G GG GGG G A Sbjct: 450 GGGGLGGGAGGGGG-LDGGAGGGAEAGGGFGGGA 482 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGG-GXGXXAXG 735 GG G G GGG F G GG G G G A G Sbjct: 512 GGAGAGGGFGGGKGGGFGGGLGGSSGSGFGGGFGAGG 548 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 126 GGGGLGGGAGGGGGLGSGGGLGG-GAGGGLGGGAGG 160 >01_01_0929 - 7344911-7345978 Length = 355 Score = 31.9 bits (69), Expect = 0.73 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP 822 P PP PP P+KT PPP P Sbjct: 15 PAPPTPPLPPSPPSKTRRPPPPPP 38 >07_03_1751 - 29215074-29216270 Length = 398 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG V G GG GGG G A G Sbjct: 187 GGGGLGGGAGGGAG-VGGGAGGGAGGGGGLGGGAGG 221 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG GGG G A G Sbjct: 309 GGAGAGGGFGGGKGGGFGGGFGG-GKGGGVGGGAGG 343 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG GG G G Sbjct: 349 GGAGAGGGFGGGKGGGFGGGVGGGHGAGGGGAGGGG 384 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G G G F G GG GGG G G Sbjct: 277 GGIGGGAGGGAGAGGGFGGGKGGGFGGGGGGGGGAG 312 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G GG GGG G A G Sbjct: 179 GGLGGGSGGGGG---LGGGAGGGAGVGGGAGGGAGG 211 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G GG GGG G G Sbjct: 265 GGLGAGGGAGGGGG-IGGGAGGGAGAGGGFGGGKGG 299 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 3/38 (7%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXG---GVPXGGGXGXXAXG 735 G G G GGG F G G GV GGG G A G Sbjct: 38 GGGGGVGHGGGVGIGFGGGKGGGVGVGGGGGFGGGAGG 75 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG F G GG GGG G Sbjct: 71 GGAGGGLGHGGGIGGGFGGGKGG-GLGGGVG 100 Score = 28.7 bits (61), Expect = 6.8 Identities = 20/62 (32%), Positives = 20/62 (32%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXPXKXXXCXXXRXXWGGXXXGXXX 663 GG G G GGG G GG GGG G A G GG G Sbjct: 217 GGAGGGAGGGGGLG---GGAGGGHGGGGGLGGGAGGGAGVGGGAGGGAGAGGGLGAGGGA 273 Query: 662 XG 657 G Sbjct: 274 GG 275 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G GG+ GGG G G Sbjct: 55 GGKGGGVGVGGGGGFG-GGAGGGLGHGGGIGGGFGG 89 Score = 28.3 bits (60), Expect = 9.0 Identities = 22/58 (37%), Positives = 22/58 (37%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G GGG L GG G G GGG AG GG GGG G A G Sbjct: 124 GGGGGLGGGGGGGAGGGLGGGAGGGA-GAGVGGG-----AGAGGGAGGGGGLGGGAGG 175 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 1/37 (2%) Frame = -2 Query: 842 GGXXXGXGXGGG-XXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 161 GGAGGGGGLGGGAGGGAGGGLGGGSGGGGGLGGGAGG 197 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 255 GGAGGGAGAGGG-----LGAGGGAGGGGGIGGGAGG 285 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG F G GG GG G G Sbjct: 314 GGGFGGGKGGGFGGGFGGGKGGGVGGGAGGGFGGG 348 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/35 (40%), Positives = 14/35 (40%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG GG GGG G A G Sbjct: 358 GGGKGGGFGGGVGGGHGAGGGGAGGGGGFGGGAGG 392 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 31.5 bits (68), Expect = 0.97 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP T P P +T PPP P P PP Sbjct: 48 PPPQPTLPPPPPRTL--PPPPPPPPPQPP 74 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP 828 P PP PP P +T PPP P P Sbjct: 47 PPPPQPTLPP-PPPRTLPPPPPPPPP 71 >07_03_0560 + 19479597-19480667 Length = 356 Score = 31.5 bits (68), Expect = 0.97 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G GGG E + GG G GGG G GG GGG G A G Sbjct: 181 GLGGGGGKEGGFGAGGGVGGGAGGGGGMGGGGGGGFGGGGGKGGGFGAGGGMGGGAGG 238 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG+ GGG G G Sbjct: 101 GGGGKGGGFGGGVGGGGGGEGGGLGGGGGGGLGGGG 136 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG V G GV GGG G Sbjct: 316 GGLGHGGGLGGGGFGVGVGVGVGVGFGGGAG 346 Score = 29.5 bits (63), Expect = 3.9 Identities = 25/104 (24%), Positives = 27/104 (25%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXPXKXXXCXXXRXXWGGXXXGXXX 663 GG G G GGG G GG GGG G G + GG G Sbjct: 107 GGFGGGVGGGGGGEGGGLGGGGGGGLGGGGGGGVGGGGGQGGGFGAGGGVGGGSGTGGGL 166 Query: 662 XGXXXXXXXXXXXXXGNPXXXGKXXXGXXXXXXGXXXXGGGXXG 531 G + G G GGG G Sbjct: 167 GGGGGGGFGGDGGGGLGGGGGKEGGFGAGGGVGGGAGGGGGMGG 210 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG AG GG+ GGG G G Sbjct: 220 GGKGGGFGAGGGMGGG-AGGGGGLGGGGGGGMGGGG 254 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG AG GG+ GGG G G Sbjct: 79 GGLGGGGGFGGGGG---AGGGGGLGGGGGKGGGFGG 111 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/53 (33%), Positives = 21/53 (39%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 G GGG + L GG G G GG + G GG+ GGG G Sbjct: 265 GFGGGAGGGAGQGGSGGLGGGGGGGLGGGGGAGGG--LGGGAGGGLGHGGGLG 315 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GG G GG GGG G G Sbjct: 213 GGGFGGGGGKGGGFGAGGGMGGGAGGGGGLGGGGGG 248 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GG G G Sbjct: 234 GGAGGGGGLGGGGGGGMGGGGGGGMGGGAGGGFGGG 269 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 PPP PP P + PPP P P PP G S Sbjct: 10 PPPRLLPPQPPPTSRPLPPPPPPP---PPAHGPS 40 >06_03_1310 + 29238644-29240260 Length = 538 Score = 31.5 bits (68), Expect = 0.97 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS--XXTXFSSXSXXXPPPXP 909 PPP TPP A P P PP GG + PPP P Sbjct: 460 PPPTTTPPGHHAPVPGTPSSPPSSSWSPPQGGGGKLPFPPVHGVAYSSPPPPP 512 >06_03_0757 + 24267599-24268882 Length = 427 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F+G G GG G A G Sbjct: 303 GGNGGGSGGGGGTRQAFSGGGGSGVSSGGGGFSAGG 338 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 31.5 bits (68), Expect = 0.97 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP PA PP P PP Sbjct: 78 PPPPPPPPPPSPPATHDVGQPPPPPSLAAPP 108 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKT--XXXPPPXPXPXXXPP 843 P PPP PP P T PPP P PP Sbjct: 77 PPPPPPPPPPPSPPATHDVGQPPPPPSLAAPPP 109 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 31.5 bits (68), Expect = 0.97 Identities = 31/125 (24%), Positives = 33/125 (26%), Gaps = 2/125 (1%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWX--PPXXXXPXAXXXXPPPXSXVXXXX 715 PPP PP P G P G+ PP P PPP Sbjct: 1100 PPPSIGAGAPPPPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPV--GGL 1157 Query: 716 XGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXX 895 GP G P P P PP + PP A P P Sbjct: 1158 GGPPAPPPPAGFRGGTP-PPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGG 1216 Query: 896 PPXXP 910 PP P Sbjct: 1217 PPPPP 1221 Score = 29.5 bits (63), Expect = 3.9 Identities = 29/121 (23%), Positives = 30/121 (24%), Gaps = 11/121 (9%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXR----GXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXX 709 PPP P PP P G P G+ PP PP Sbjct: 1111 PPPPPGGITGVPPPPPIGGLGGHQAPPAPPLPEGIGGVPPPPPVGGLGGPPAPPPPAGFR 1170 Query: 710 XXXGPFXXXLXRXXPGPXPRA-------PLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXP 868 P P P PR P P P PP P P G P Sbjct: 1171 GGTPPPNAHGGVAPPPPPPRGHGGVGGPPTPPGAPAPPMPPGVPGGPPPPPGGRGLPAPP 1230 Query: 869 G 871 G Sbjct: 1231 G 1231 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/65 (30%), Positives = 21/65 (32%), Gaps = 8/65 (12%) Frame = +1 Query: 685 PPXXXRXXXQXXXFXGXPXAXXPXPPPXG---TPPXXPAKTXXXPPPXPXP-----XXXP 840 PP R G P P PP G P P+ PPP P P P Sbjct: 1065 PPPPQRENTSVGIQGGIPPLPPPLPPTLGDYGVAPPPPSIGAGAPPPPPPPGGITGVPPP 1124 Query: 841 PXXGG 855 P GG Sbjct: 1125 PPIGG 1129 >04_01_0034 - 401208-402923 Length = 571 Score = 31.5 bits (68), Expect = 0.97 Identities = 18/62 (29%), Positives = 19/62 (30%) Frame = +1 Query: 658 PXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXX 837 P + PP Q P P PPP PP PPP P P Sbjct: 274 PAAKQAAAAPPMRAPLAEQQPHAPRLPLQPRPAPPPP--PPQQQRAKPSRPPPPPPPLDP 331 Query: 838 PP 843 PP Sbjct: 332 PP 333 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 31.5 bits (68), Expect = 0.97 Identities = 18/55 (32%), Positives = 20/55 (36%), Gaps = 2/55 (3%) Frame = +1 Query: 757 PPPXGTPPXXPAK--TXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 PPP PP A T PPP P P + + S PPP P A Sbjct: 303 PPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPPAPSPSAAGAGSGPPPPPPPAA 357 Score = 28.3 bits (60), Expect = 9.0 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 2/60 (3%) Frame = +1 Query: 736 PXAXXPX--PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P A P PPP PP P+ P P PP G T PPP P Sbjct: 273 PAAPPPPAGPPPPAPPPLPPSHHHHHGHHPPPPHPLPPGAGAGAGT-------GAPPPPP 325 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 31.5 bits (68), Expect = 0.97 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG V G GG GGG G G Sbjct: 158 GGDVGGDGGGGGDGNVGGGGGGGGGGGGGGGGGGGG 193 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP---XPXXXPPXXGGS 858 P PPP PP P PP P P PP GG+ Sbjct: 265 PRPPPPQVPPPPPQAPPPPPPNAPMGMPPRIPPPPVGGT 303 Score = 30.3 bits (65), Expect = 2.2 Identities = 24/86 (27%), Positives = 26/86 (30%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP G P P PP GT P P PP Sbjct: 264 PPRPPPPQVPP---PPPQAPPPPPPNAPMGMPPRIPP-PPVGGTQPPPPPPPLANGPPRS 319 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPP 900 P PP G F+ + PP Sbjct: 320 IP---PPPMTGGAMANFTPGAPPRPP 342 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 31.5 bits (68), Expect = 0.97 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G GG GGG G G Sbjct: 82 GGGYGGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGG 117 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 86 GGGGRGGGGGGGYGGGGGGGRGGGGGGGGRGGGGRG 121 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGG 756 GG G G GGG + G GG GGG Sbjct: 48 GGRGRGGGGGGGGGYGGGGVGGGYGGGGG 76 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 65 GGVGGGYGGGGGGYGGGGGGYGGGGRGGGGGGGYGG 100 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G G GGG G G Sbjct: 46 GGGGRGRGGGGGGGGGYGGGGVGGGYGGGGGGYGGG 81 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 54 GGGGGGGGYGGGGVGGGYGGGGGGYGGGGGGYGGGG 89 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P PP TPP PA PP P PP T ++ + PPP P A Sbjct: 215 PPPPSIATPPPSPAS-----PPPPSTATPPP----PSPTPTTTRASPTPPPIPTA 260 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/77 (25%), Positives = 24/77 (31%) Frame = +1 Query: 685 PPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXX 864 PP R P + PP +PP P T PPP P P Sbjct: 200 PPTIARPPRPLPPASPPPPSIATPPPSPASPP--PPSTATPPPPSPTP---TTTRASPTP 254 Query: 865 TXFSSXSXXXPPPXPXA 915 + + PPP P A Sbjct: 255 PPIPTATVRPPPPLPRA 271 >07_03_0558 + 19461369-19462448 Length = 359 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG + G GG GGG G A G Sbjct: 59 GGGGGGGLGGGGGGLGGGHGGGFGGGGGLGGGASG 93 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = -2 Query: 842 GGXXXGXGXG-GGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G G GG V +G GGV GGG G G Sbjct: 249 GGLGGGHGGGFGGGAGVGSGAGGGVGGGGGFGGGGGG 285 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/36 (47%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG V G GGV GGG G G Sbjct: 149 GGHGGGFGAGGG---VGGGAGGGVGGGGGFGGGGGG 181 Score = 30.7 bits (66), Expect = 1.7 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 842 GGXXXGXGXG-GGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G G GG V G GGV GGG G G Sbjct: 285 GGLGGGHGSGFGGGAGVGGGAGGGVGGGGGFGGGGGG 321 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GGV GGG G G Sbjct: 75 GGHGGGFGGGGGLG---GGASGGVGGGGGFGGGGGG 107 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 842 GGXXXGXGXG-GGXXWVFAGXXGGVPXGGGXG 750 GG G G G GG V G GGV GGG G Sbjct: 181 GGLGGGHGGGFGGGAGVGGGAGGGVGGGGGFG 212 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG+ GGG G G Sbjct: 215 GGSGLGGGQGGGFG-AGGGAGGGIGGGGGFGGGGGG 249 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GGV G G G G Sbjct: 139 GGGGGGLGGGGGHGGGF-GAGGGVGGGAGGGVGGGG 173 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = -2 Query: 842 GGXXXGXGXGGGXX---WVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG V G GGV GGG G G Sbjct: 319 GGGGLGGGHGGGFGAGAGVGGGAGGGVGGGGGFGGGGGG 357 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 G GGG + GG G G GGG G GG+ GGG G Sbjct: 103 GGGGGGLGGGQGGGFGGGAGAGGGAGGGLGGGGGFG---GGGGGGLGGGGGHG 152 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 133 GGGGFGGGGGGGLGGG-GGHGGGFGAGGGVGGGAGG 167 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG F G GG GGG G Sbjct: 44 GGFGEGEGFGGGGG--FGGGGGGGLGGGGGG 72 >04_04_1149 + 31273203-31273695,31274016-31275165,31275617-31277078 Length = 1034 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 P G G G GGG + G GG GGG G G Sbjct: 59 PGGGRGYGGGGGGGGRGYGGGGGGGGYESGGGRGYGGGG 97 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 P GG G GGG + G GG GGG G Sbjct: 48 PPGGGGGRGYEPGGGRGYGGGGGGGGRGYGGGGG 81 >04_04_1125 + 31085106-31085714 Length = 202 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/53 (32%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P T P P P PP + + PPP P Sbjct: 39 PPPPPCQPPP--PTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTP 89 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/69 (28%), Positives = 21/69 (30%), Gaps = 2/69 (2%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXP--PP 816 PP P P+ P P P P TPP PA T P PP Sbjct: 41 PPPCQPPPPTPTPATPTTPPTPWTPPPATPTPPTPTPWTPTPATPPPTPA-TPATPTTPP 99 Query: 817 XPXPXXXPP 843 P P P Sbjct: 100 TPAPAPSTP 108 >03_01_0023 + 198414-198968 Length = 184 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 854 PPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 P GG G G GGG G GG GGG G G Sbjct: 35 PGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGGSG 74 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 54 GGGGSGGGSGGGGGSGGGGSGGGGSGGGGSGGGGGG 89 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -2 Query: 854 PPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 P GG G G GGG G G GGG G G Sbjct: 33 PSPGGGGGGGGGGGGGGGGRGGGGGSGGGSGGGGGSGGGG 72 >02_05_1277 - 35408097-35409080 Length = 327 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P PPP PP A PPP P Sbjct: 57 PSTPAPPPPPPAQPPVLAAPAPAPPPPQP 85 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPP---PXPXPXXXPPXXG 852 P PPP PP P PP P P P PP G Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPPG 155 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP PP P PPP P PP Sbjct: 119 PPPPPPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 31.1 bits (67), Expect = 1.3 Identities = 25/91 (27%), Positives = 28/91 (30%), Gaps = 2/91 (2%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP P P P P G+PP P PPP Sbjct: 147 PPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPV---PAPAPAGSPPPPP------PPPAG 197 Query: 823 XPXXXPPXXGGSXXTXFS--SXSXXXPPPXP 909 P GG T + + PPP P Sbjct: 198 GNFTAPSPAGGMNFTAPAPGTNGTAAPPPRP 228 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/53 (28%), Positives = 16/53 (30%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP T P P PPP + S PPP P Sbjct: 143 PSPPPPPTVPAAPTPRPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPPPPPPP 195 >01_01_0570 - 4231100-4232560 Length = 486 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG+ GGG G A G Sbjct: 220 GGSGFGGGAGGGFG-AGGGVGGGIGVGGGMGGGASG 254 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + G GG GGG G G Sbjct: 174 GGAGAGGGVGGGGRFGGGGMGGGGGFGGGAGGGVGG 209 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 G GGG + GG G GGG G GG GGG G Sbjct: 131 GSGGGVGAGGGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGAGAGGGVG 183 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGG 756 GG G G GGG AG GG GGG Sbjct: 67 GGVGVGGGVGGGTGGGAAGGLGGGGGGGG 95 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVF---AGXXGGVPXGGGXGXXA 741 GG G G G G F AG GG+ GGG G A Sbjct: 140 GGLRGGGGVGAGGGGGFGGGAGGGGGIGAGGGFGGGA 176 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/106 (25%), Positives = 30/106 (28%), Gaps = 1/106 (0%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRG-FLXPPXXXPXXXXPSXXPPXXXRXXXQX 717 PP P P P + G F PP P P P + Q Sbjct: 647 PPSYEPSPPSYEPSPPEYAPEPPVYAPYPPGIFPSPPEYSPE---PPSYVPSPPQYAPQP 703 Query: 718 XXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 + P P PP P P T P P P PP GG Sbjct: 704 PSYVPSPPEYAPEPPVYA--PYPPGITPSPPEYAPEPPPGPPGGGG 747 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/40 (37%), Positives = 15/40 (37%), Gaps = 4/40 (10%) Frame = +1 Query: 736 PXAXXPXPPPXGT----PPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP PP PA T P P P PP Sbjct: 374 PPNPPPPPPPMSPSCLLPPIIPAPTFTYSSPPPPPLYYPP 413 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P PPP P P PP Sbjct: 425 PPPPPLPPPPPPP-----PPPPPPLPPNMPP 450 Score = 29.5 bits (63), Expect = 3.9 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PPP PP P PP P P Sbjct: 428 PPLPPPPPPPPPPPPPLPPNMPPPLPPPPEP 458 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PPP PP P PPP P P Sbjct: 426 PPPPLPPPPPP-PPPPPPPLPPNMPPPLPPP 455 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PP PP P PP P P PP Sbjct: 426 PPPPLPPPPPPPPPPPPPLPPNMPPPLPPPP 456 >07_03_0559 + 19475893-19476783 Length = 296 Score = 30.7 bits (66), Expect = 1.7 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG AG GG+ GGG G G Sbjct: 181 GGKGGGFGAGGGVGGA-AGGGGGMGSGGGGGFGGGG 215 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVF-AGXXGGVPXGGGXG 750 GG G G GGG F G GGV GGG G Sbjct: 111 GGSGAGGGLGGGGGGGFGGGSGGGVGGGGGQG 142 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVF-AGXXGGVPXGGGXG 750 GG G G GGG F G GG+ GGG G Sbjct: 153 GGSGTGGGLGGGGGGGFGGGGGGGIGGGGGKG 184 Score = 28.7 bits (61), Expect = 6.8 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 165 GGGGFGGGGGGGIGGG-GGKGGGFGAGGGVGGAAGG 199 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/78 (25%), Positives = 22/78 (28%), Gaps = 12/78 (15%) Frame = +1 Query: 646 PXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTP------------PXXP 789 P P P+ PP P P PPP +P P P Sbjct: 47 PNATPADTTPTSPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPP 106 Query: 790 AKTXXXPPPXPXPXXXPP 843 T PP P P PP Sbjct: 107 TTTTTTPPTAPVPAAAPP 124 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/56 (28%), Positives = 18/56 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PP +PP A P P P PP S S + PP Sbjct: 51 PADTTPTSPPPASPPLPSATPPLAASPPPPPPPPPPRNSPSPPKPPSQAAQSPLPP 106 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 30.7 bits (66), Expect = 1.7 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G + G Sbjct: 48 GGGSGGGGGGGGGGGGGGGSGGGCGGGGGGGGGSSG 83 >01_06_0719 + 31474028-31474476,31474881-31474939,31479145-31479983 Length = 448 Score = 30.7 bits (66), Expect = 1.7 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 827 GXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G G + G GG P GGG G G Sbjct: 306 GRGAGAGVGGITGGGDGGFPGGGGGGFSGGG 336 Score = 30.3 bits (65), Expect = 2.2 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXA 741 GG G G GGG G GG GGG G A Sbjct: 278 GGGGGGKGGGGGGGGNTGGGIGGSTGGGGRGAGA 311 Score = 29.1 bits (62), Expect = 5.2 Identities = 20/61 (32%), Positives = 22/61 (36%), Gaps = 3/61 (4%) Frame = -2 Query: 908 GXGGGXXXEXEENXVXXLPPXXGGXXXGXGXG---GGXXWVFAGXXGGVPXGGGXGXXAX 738 G GG E + L GG G G G GG G GG+ GGG G Sbjct: 184 GGDGGGGGEFWTSGGGGLAIGGGGDGVGLGLGLDGGGGGGFTGGRGGGLTGGGGEGNTGG 243 Query: 737 G 735 G Sbjct: 244 G 244 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/28 (42%), Positives = 12/28 (42%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 PPP T P P PPP P P P Sbjct: 54 PPPTQTAPPVPVVISEPPPPQPQPEPQP 81 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP P PA PPP P PP Sbjct: 64 PVVISEPPPPQPQPEPQPAAPSQPPPPQEQPSPPPP 99 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 30.3 bits (65), Expect = 2.2 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 P PPP P P PP P P P GG+ Sbjct: 55 PPPPPPPPAPFFPFLPDSAPPQLPPPVTTPAPAGGA 90 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/53 (32%), Positives = 20/53 (37%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 PPP P P PPP P P PP + + + PPP P A Sbjct: 257 PPPQSVRPPPP------PPPPPPPPPMPPRTDNAS----TQAAPAPPPPLPRA 299 >07_03_0177 - 14770777-14772045 Length = 422 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG+ GGG G G Sbjct: 339 GGLGGGFGKGGGIGGGF-GKGGGLGGGGGLGGGGGG 373 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/62 (32%), Positives = 22/62 (35%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXPXKXXXCXXXRXXWGGXXXGXXX 663 GG G G GGG + G GG+ GGG G G K GG G Sbjct: 71 GGGGGGGGFGGGGGFG-GGGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGGGFGKGGGF 129 Query: 662 XG 657 G Sbjct: 130 GG 131 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/36 (44%), Positives = 17/36 (47%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG+ GGG G G Sbjct: 247 GGLGGGIGKGGGLGGGF-GKGGGLGGGGGLGGGEDG 281 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG F G GG+ GGG G Sbjct: 173 GGLGGGIGKGGGLGGGF-GKSGGLGGGGGLG 202 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG F G GG+ GGG G Sbjct: 205 GGLGGGIGKGGGLGGGF-GKGGGLGGGGGLG 234 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 353 GGFGKGGGLGGGGGLGGGGGGGGGGFGGGGGSGIGG 388 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/51 (35%), Positives = 21/51 (41%) Frame = -2 Query: 902 GGGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GGG E+ + GG G G GGG G GG+ GGG G Sbjct: 271 GGGGLGGGEDGGLGGGIGKGGGIGGGFGKGGG-----LGGGGGLGGGGGLG 316 >07_01_0479 + 3606663-3607448 Length = 261 Score = 30.3 bits (65), Expect = 2.2 Identities = 21/71 (29%), Positives = 21/71 (29%), Gaps = 4/71 (5%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPX----PPPXGTPPXXPAKTXXXP 810 PP P P P R F G P PPP G P P P Sbjct: 170 PPGQMPPPMRPPQMPIPFQRPPGVPPAFPGGPPPPPGPFMRGPPPMGPPQVRPG-MPGGP 228 Query: 811 PPXPXPXXXPP 843 PP P PP Sbjct: 229 PPGMRPGMPPP 239 Score = 28.7 bits (61), Expect = 6.8 Identities = 30/103 (29%), Positives = 30/103 (29%), Gaps = 2/103 (1%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXP-LFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQX 717 PPP P F G P F G PP P P P R Sbjct: 169 PPPGQMPPPMRPPQMPIPFQRPPGVPPAFPGG--PPPPPGPFMRGPPPMGPPQVRPGMPG 226 Query: 718 XXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPX-PXXXPP 843 G P P PP PP P PPP P P PP Sbjct: 227 ----GPPPGMRPGMPP---PPFRPGMPP--PPPGPQQPGQNPP 260 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +1 Query: 736 PXAXXPXPPPX--GTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P P PP G PP P PPP P P GG Sbjct: 186 PFQRPPGVPPAFPGGPPPPPGPFMRGPPPMGPPQVRPGMPGG 227 >05_01_0351 + 2750253-2751042,2751951-2751958,2752122-2752149, 2754692-2754775,2755780-2757548 Length = 892 Score = 30.3 bits (65), Expect = 2.2 Identities = 31/100 (31%), Positives = 31/100 (31%), Gaps = 5/100 (5%) Frame = +1 Query: 625 SRGFLXPPXXXPXXXX--PSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGT---PPXXP 789 S GF PP P P PP R Q P P PPP P P Sbjct: 701 SVGFAPPPLQPPARPAQHPHLQPPA--RPAQQPPR----PPVTQPLPPPPPLHQHQPYQP 754 Query: 790 AKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 T P P P P PP FS PPP P Sbjct: 755 RHTDALPLPLPLPPPPPP--------PFSVQQQQLPPPPP 786 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/60 (30%), Positives = 19/60 (31%), Gaps = 2/60 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXP--PPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP KT P PP P P PP + S P P P Sbjct: 368 PPPPPPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPPLLAPKQQSSGGPILPPAPAP 427 >04_03_1022 - 21778315-21779007 Length = 230 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP T P + PP P P PP Sbjct: 16 PPPPPPATRARPPCSSAHLLPPPPPPPPPPP 46 >02_04_0005 - 18843061-18843201,18843309-18843440,18844457-18845315, 18845884-18845973,18846748-18846869,18846950-18847049, 18847151-18847205,18847275-18847365,18847453-18847572, 18847681-18847780,18847890-18848018,18848099-18848201, 18848670-18848743,18848848-18848933,18849297-18849358, 18849454-18849541,18849937-18850029 Length = 814 Score = 30.3 bits (65), Expect = 2.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP TPP P PP PP Sbjct: 672 PPPPPSSTPPVEPVAVFPPPPSPACGVYYPP 702 >01_05_0490 + 22672241-22674679 Length = 812 Score = 30.3 bits (65), Expect = 2.2 Identities = 18/62 (29%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Frame = +1 Query: 736 PXAXXPXPPP----XGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PPP PP P++ PPP P P PP ++ PP Sbjct: 638 PPQPPPPPPPTTRRSRKPPQPPSR--PAPPPPPPPQQQPPFYPRRAVVYYTYPLPPPSPP 695 Query: 904 XP 909 P Sbjct: 696 LP 697 >12_02_0118 - 13869237-13869307,13869375-13869465,13870321-13870440, 13870668-13870795,13871159-13871270,13871719-13871817, 13871918-13871992,13872099-13872320,13873177-13874034 Length = 591 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/60 (33%), Positives = 23/60 (38%) Frame = +1 Query: 724 FXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 F G P A PPP G PP A+ PPP P G S + + PPP Sbjct: 151 FGGPPAAVASQPPPFGGPPVAAAQ----PPPFGRP-PSAAAAGQSAPLGGALFAAAQPPP 205 Score = 29.5 bits (63), Expect = 3.9 Identities = 33/131 (25%), Positives = 35/131 (26%), Gaps = 5/131 (3%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P PP P PS P + Sbjct: 59 PQAPPPGAR-PFPGSPPPPSQPPPPFARPAAPVQQQPPPFGGPPGVMPSQ--PLQQQQQQ 115 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP-----XPXPXXXPPXXGGSXXTXFS 876 Q F G PP G PP +T PP P P PP S F Sbjct: 116 QRPAFGG---------PPSGAPPAQAQRTPFGGPPSAMSQGPLPFGGPPAAVASQPPPFG 166 Query: 877 SXSXXXPPPXP 909 P P Sbjct: 167 GPPVAAAQPPP 177 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPA-KTXXXPPPXPXPXXXPP 843 P P PP PP P + PPP P P PP Sbjct: 30 PPHPPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPP 66 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/41 (31%), Positives = 14/41 (34%) Frame = +1 Query: 787 PAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P + PPP P P PP T PPP P Sbjct: 20 PPELRLPPPPPPHPPPPPPLEPAPPSTPQLRGEASPPPPPP 60 >08_02_1329 - 26182762-26183007,26183149-26183249,26183533-26183602, 26183692-26183895,26186435-26186941,26188672-26188677 Length = 377 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P P PP P+ P P P P GGS ++ PP Sbjct: 63 PSPSRAPPPPPSHHERAPSDAPPPPPPAPYAGGSPYHRHAAGGGETPP 110 >08_02_0672 - 19904353-19904839,19905646-19905704,19906137-19906352, 19906845-19907422,19907506-19908180,19908263-19908653, 19909469-19909621,19909727-19909980,19911023-19911479 Length = 1089 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/47 (29%), Positives = 16/47 (34%) Frame = +2 Query: 770 APLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 AP P PP + PP G PG+P PP P Sbjct: 75 APSFRPLGAPPPPPPPQQVQVQVPPQYGGVPNPGYPMAQQMQPPGVP 121 >07_01_0862 - 7172083-7172931 Length = 282 Score = 29.9 bits (64), Expect = 2.9 Identities = 18/62 (29%), Positives = 19/62 (30%), Gaps = 2/62 (3%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS--XXTXFSSXSXXXPPPXP 909 P P P PP P K PPP P P P + PPP P Sbjct: 160 PLPLPPRKKPLLYPPPLPPKKKPLPPPSPPPQPPLPEKENTPLPPLLLPPKKKPLPPPSP 219 Query: 910 XA 915 A Sbjct: 220 TA 221 >05_06_0281 + 26912419-26913099 Length = 226 Score = 29.9 bits (64), Expect = 2.9 Identities = 17/62 (27%), Positives = 21/62 (33%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 G P P PP TPP P P PP G+ ++ + PP P Sbjct: 146 GRPWPKAPPPPDPNTPPVQPLSNYGVSRCCGRPGPAPPTPAGNPPGE-TNVAVALAPPIP 204 Query: 910 XA 915 A Sbjct: 205 CA 206 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP +PP ++ PP P P PP Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPP 37 >04_03_0904 + 20717005-20718087 Length = 360 Score = 29.9 bits (64), Expect = 2.9 Identities = 22/90 (24%), Positives = 25/90 (27%), Gaps = 1/90 (1%) Frame = +1 Query: 643 PPXXXPXXXXPSXXP-PXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPX 819 PP P P P P + P P PPP P P T P P Sbjct: 118 PPKPTPPTYKPQPKPTPAPYTPTPTPPTYKPQPK---PTPPPTYKPQPKPTPTPYTPTPT 174 Query: 820 PXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P + T + P P P Sbjct: 175 PPSYKPQPKPTPTPYTPTPTPPSYKPQPKP 204 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 758 PXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPP 901 P P P KP PP P P PP P + PP Sbjct: 211 PTPTPPSYKPQPKPNPPPTYKPQPKPNPPPTYKPAPPTYKPQPKPNPP 258 >04_03_0711 + 18945012-18945692,18945790-18946845,18946863-18947066 Length = 646 Score = 29.9 bits (64), Expect = 2.9 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP G P+ T PPP P P P Sbjct: 531 PPPYGYASYYPSVTPVQPPPPPPPAGADP 559 Score = 28.7 bits (61), Expect = 6.8 Identities = 23/94 (24%), Positives = 25/94 (26%), Gaps = 5/94 (5%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGT----PPXXPAKTXXXP 810 P P PP + P P PPP G+ P P P Sbjct: 387 PQPAVPPGPPAVPAPPTYPPADPAAGGYTSQPYMGAPPPPPPGSYAPVPWGQPPPYASYP 446 Query: 811 PPXP-XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P PP T PPP P Sbjct: 447 PPPPGSSMYNPPPPAPGQATPPPYGVQYAPPPAP 480 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 29.9 bits (64), Expect = 2.9 Identities = 20/68 (29%), Positives = 21/68 (30%), Gaps = 5/68 (7%) Frame = +1 Query: 628 RGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGT-----PPXXPA 792 R L PP P R F + P PPP T PP PA Sbjct: 29 RSVLPPPPAPHHAPPPPGAHVHYFRAASPIPIFRAAASSRPPRPPPPSTTTAPPPPAAPA 88 Query: 793 KTXXXPPP 816 T PPP Sbjct: 89 VTPARPPP 96 >03_02_0514 + 9038606-9039790,9040211-9040432,9040548-9040655, 9041608-9041802,9041905-9042153,9042525-9042672, 9042673-9042779,9043311-9043475,9044506-9045948 Length = 1273 Score = 29.9 bits (64), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G GGG W G GG GGG G Sbjct: 92 GGGAGGPLGGGGGGWGAGGGGGGGGGGGGGG 122 >02_04_0021 + 18975992-18976408 Length = 138 Score = 29.9 bits (64), Expect = 2.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P P P TPP PA T PP P P PP G Sbjct: 98 PPPKPKPTPPP-PAPTPK--PPAPSPSPPPPKAAG 129 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPP 816 P P PPP P PA + PPP Sbjct: 99 PPKPKPTPPPPAPTPKPPAPSPSPPPP 125 >02_03_0120 + 15463163-15465250 Length = 695 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/38 (34%), Positives = 14/38 (36%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 G P + PP P P PPP P P PP Sbjct: 276 GFPNSSYAPPPTKYIGPMPPNNQPLPPPPSPSPSPPPP 313 >02_02_0444 + 10340927-10341063,10341157-10341241,10341480-10341537, 10343738-10345885,10345943-10346388 Length = 957 Score = 29.9 bits (64), Expect = 2.9 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAG-XXGGVPXGGG 756 GG G G GG W++ G GG+ GGG Sbjct: 362 GGDVVGGGLNGGGGWLYDGATVGGLDEGGG 391 >01_01_0482 + 3535083-3535194,3535301-3535467 Length = 92 Score = 29.9 bits (64), Expect = 2.9 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPP 816 P P P +PP PA T PPP Sbjct: 68 PPPAPVSSPPIGPAPTLLPPPP 89 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 P G G G GGG + G GG GGG G Sbjct: 52 PGGRGGGYGGGGGGGGPPYYGGGGGGGGGGGGQG 85 >07_01_0682 - 5141194-5141251,5141526-5141839 Length = 123 Score = 29.5 bits (63), Expect = 3.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = -2 Query: 839 GXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 G G G GGG F G GGV GGG G G Sbjct: 75 GPFGGFGAGGGP---FGGFGGGVGLGGGGGGFRPG 106 >06_03_0790 - 24636805-24637770 Length = 321 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 117 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 83 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 118 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 84 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 119 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 85 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 120 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 87 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRG 122 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 89 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGG 124 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 90 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGG 125 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 92 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 127 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 96 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 131 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 97 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 132 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 98 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 101 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 136 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 137 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 105 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 140 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 106 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 141 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 108 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 143 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 109 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 144 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 88 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGG 123 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 104 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 139 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 107 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 142 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 115 GGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGNGG 150 >06_03_0447 + 20878444-20878821 Length = 125 Score = 29.5 bits (63), Expect = 3.9 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXP-XXXPPXXGG 855 PPP PP PPP P P PP GG Sbjct: 49 PPPRPIPPDLVEGRALAPPPPPLPLTTLPPDSGG 82 >06_01_0383 - 2749030-2750160,2752418-2752488,2753470-2753791 Length = 507 Score = 29.5 bits (63), Expect = 3.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGG 759 P G GGG WV G GGV GG Sbjct: 45 PTPASHSGSHGGGGGGGWVGEGGIGGVDEGG 75 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/61 (29%), Positives = 20/61 (32%), Gaps = 3/61 (4%) Frame = +1 Query: 736 PXAXXPXPP-PXGTPP--XXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPX 906 P P PP P PP PP P P PP + S + PPP Sbjct: 41 PVVGSPPPPSPPPPPPLDEETLAQFPSPPTNPSPPPPPPLDADAAAEAAPSPALTSPPPN 100 Query: 907 P 909 P Sbjct: 101 P 101 >03_05_0690 + 26778567-26778804,26778950-26779024,26779995-26780099, 26780869-26781000,26781432-26781571,26782213-26782323, 26782690-26782812,26784166-26784267,26784536-26784546, 26784878-26785103,26785363-26785401,26785413-26785583, 26785674-26785753,26785976-26786039 Length = 538 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG V GG GGG G G Sbjct: 16 GGGGGGGGGGGGGGGVGGDRGGGGSGGGGPGMGRRG 51 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 35 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGG 70 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 39 GGGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGG 74 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 40 GGGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGG 75 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 41 GGGGGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 76 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 44 GGGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGG 79 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 45 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGG 80 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 48 GGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGG 83 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 49 GGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGG 84 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGG 86 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 52 GGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGG 87 Score = 29.5 bits (63), Expect = 3.9 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 56 GGGGGGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGG 91 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 47 GGGGGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 50 GGGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGGGGG 85 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 62 GGRGGGGGGGGGGGGGGGGGGGGGGGGGGGG 92 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/66 (27%), Positives = 18/66 (27%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PS PP P PP P T PPP P Sbjct: 368 PPPPPPRRKPPSPSPPSSPLIENTSALRSTTTTDTTIPRNPFVQPPPPPTHTHGPPPPPP 427 Query: 823 XPXXXP 840 P P Sbjct: 428 PPPPPP 433 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 29.5 bits (63), Expect = 3.9 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP 828 P PPP PP + PPP P P Sbjct: 967 PPPPPNVAPPPFTRQDIPPPPPSPPP 992 >10_08_1008 - 22222051-22222377,22222479-22222640,22223179-22223310, 22224556-22224608,22224713-22225256 Length = 405 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P A P PPP PP PPP P P Sbjct: 22 PPAAAPAPPPSQPPPPPLPFAQQAPPPAANPAAAP 56 >10_08_0214 - 15915156-15915713 Length = 185 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G G GGG G A G Sbjct: 36 GGGGGGEGGGGGYGGSGYGSGSGYGEGGGSGGAAGG 71 >09_02_0403 + 8590195-8590443,8590583-8590690,8590788-8590901, 8590998-8591210 Length = 227 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -2 Query: 899 GGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG E E + GG GGG FAG GG GGG G Sbjct: 4 GGRLEEQPEGPIGGSQVDIGGLAFQGDMGGGG---FAGGSGGAGAGGGDG 50 >06_03_0395 - 20354713-20355570 Length = 285 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP T P P P P P PP Sbjct: 247 PSPPPAATLPDPPEAARIWRSPSPLPWAAPP 277 >06_01_0178 + 1386981-1387505 Length = 174 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG AG GG GG G G Sbjct: 37 GGGGGGGGGGGGGGGGGAGGKGGKGGAGGHGGAGGG 72 >03_05_0630 + 26260159-26260272,26260520-26260894 Length = 162 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG + GG GGG G G Sbjct: 104 GGGRGGGGYGGGGGGGYGRREGGYGGGGGYGGGRGG 139 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 108 GGGGYGGGGGGGYGRREGGYGGGGGYGGGRGGGGGG 143 >03_05_0292 + 22846273-22846377,22847161-22847823 Length = 255 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG A GG GGG G G Sbjct: 49 GGGGRGRGGGGGGRGDGARDGGGARGGGGRGARGGG 84 >03_05_0153 + 21299150-21299593,21299733-21299873,21299971-21300084, 21300181-21300354,21300486-21300494 Length = 293 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/50 (36%), Positives = 19/50 (38%) Frame = -2 Query: 899 GGXXXEXEENXVXXLPPXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG E E + GG GGG FAG GG GGG G Sbjct: 69 GGRLEEQPEGPIGGSQVDIGGLAFQGDMGGGG---FAGGSGGAGAGGGDG 115 >03_03_0160 + 14957139-14957603,14958054-14958113,14959012-14959776 Length = 429 Score = 29.1 bits (62), Expect = 5.2 Identities = 29/116 (25%), Positives = 30/116 (25%), Gaps = 2/116 (1%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSP-GXRGXP-FFXGVSWXPPXXXXPXAXXXXPPPXSXVX 706 P PPP P P P +P G P G P PP Sbjct: 194 PPTPPPTPRGFPPPLPSPGAGAPRGGSATPAMIPGHPGAFYPFPPPSLPGVGPPRGGGAI 253 Query: 707 XXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGF 874 F L P P P P P PP P P P PGF Sbjct: 254 PGLPAGFPFLLRPPPPLPVPGVICRP----PPSPPYFAPPPRATPTVSLAGPPPGF 305 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 28.7 bits (61), Expect = 6.8 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 851 PXXGGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 P GG G GGG + G GG GGG G G Sbjct: 3 PPRGGGGGRFGGGGGGRFGGGGGRGGRFGGGGRGGRGGG 41 >10_08_0683 - 19860777-19861070,19861677-19861874,19862498-19862659, 19862763-19862911,19863089-19863236,19863317-19863385, 19863471-19863719,19863937-19864131,19864444-19864560, 19864978-19866537 Length = 1046 Score = 28.7 bits (61), Expect = 6.8 Identities = 21/91 (23%), Positives = 22/91 (24%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP P P P P +P P P P Sbjct: 78 PPPQHHAYPPPQPHPPSPYVYDPYHAPAAAYPSYPSPNPSPSISPSSSFHHHPEPPSPSP 137 Query: 823 XPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P G S PPP P A Sbjct: 138 SAPSYPSIADGLANMHVSDRHDYPPPPSPAA 168 >10_03_0023 - 7151465-7152111,7152222-7152405 Length = 276 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/32 (40%), Positives = 13/32 (40%), Gaps = 1/32 (3%) Frame = +1 Query: 751 PXPPPXGT-PPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P PPP P P P Sbjct: 218 PQPPPSSLIPPVLPLPLLNPPPPPPPPPSLLP 249 >09_01_0037 - 604001-604957 Length = 318 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P+ PP P PP Sbjct: 226 PAVQLQPPPPSQMPPPTPSCVRQEPPQMPFQLQPPP 261 >08_02_1455 + 27230134-27231110,27231195-27231327,27231417-27231501, 27233372-27233571 Length = 464 Score = 28.7 bits (61), Expect = 6.8 Identities = 19/59 (32%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXT-XFSSXSXXXPPPXP 909 P A PP PP P+ + PPP P S FS S PPP P Sbjct: 103 PYADLAAPP--AIPPSPPSSSSDPPPPGLPPRKGGHRRSQSDIPFGFSHLSPPLPPPAP 159 >07_03_1433 + 26513728-26514135,26525534-26526280 Length = 384 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP---XXGGSXXTXFSSXSXXXPPPXP 909 PP T P P+ + PP P P PP S T + S P P P Sbjct: 28 PPTPITYPSPPSLSPSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPPNPAP 81 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP TPP + P P P PP Sbjct: 42 PSMPPTYPPPSSTPPSPAPVSPSPPTTYPPPSTTPP 77 >07_03_1432 - 26508135-26508881,26509301-26509708 Length = 384 Score = 28.7 bits (61), Expect = 6.8 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP---XXGGSXXTXFSSXSXXXPPPXP 909 PP T P P+ + PP P P PP S T + S P P P Sbjct: 28 PPTPITYPSPPSLSPSTPPTYPPPSSTPPSLAPVSPSPPTTYLPPSPTPPSPAP 81 >07_03_0890 - 22332768-22333382 Length = 204 Score = 28.7 bits (61), Expect = 6.8 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 769 GTPPXXPAKTXXXPPPXPXP 828 G+PP PA+ PPP P P Sbjct: 73 GSPPPPPAEATPPPPPPPPP 92 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/35 (34%), Positives = 12/35 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P P PPP PP PP P P P Sbjct: 79 PAEATPPPPPPPPPPERAVPEAADTPPPPPPPTAP 113 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/34 (35%), Positives = 13/34 (38%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 A P PPP P + PPP P P P Sbjct: 82 ATPPPPPPPPPPERAVPEAADTPPPPPPPTAPTP 115 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP P A T PPP P PP Sbjct: 84 PPPPPPPPPPERAVP-EAADTPPPPPPPTAPTPTPP 118 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/28 (39%), Positives = 11/28 (39%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PP PP P PPP P PP Sbjct: 58 PPHAPPPQQPPAMWGQPPPPPPQYAPPP 85 >06_03_1006 + 26844161-26844198,26844304-26844372,26844526-26844591, 26844831-26844902,26844982-26845053,26846179-26846244, 26846409-26846881,26846966-26847324,26847429-26847697, 26847780-26847918,26848323-26848462,26848612-26848768, 26848925-26848978,26849457-26849539,26851085-26851136 Length = 702 Score = 28.7 bits (61), Expect = 6.8 Identities = 12/36 (33%), Positives = 12/36 (33%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P P P G P P P P P PP Sbjct: 157 PTRPAPSPSPTGPPTPSPTNPNLEPSPPPPSSSAPP 192 >05_07_0162 + 28090579-28091343 Length = 254 Score = 28.7 bits (61), Expect = 6.8 Identities = 14/48 (29%), Positives = 16/48 (33%) Frame = +3 Query: 768 GHPSXPXXKNPXXPPXXXXSXXXSPPXGGXXXXXVFLXLXXXPPPXPP 911 G P P P PP +P FL + PPP PP Sbjct: 61 GPPLYPVFGRPRSPPPTPPPHRQAPEKASRLPLWRFLMVDHGPPPPPP 108 >03_02_0738 - 10824121-10825572 Length = 483 Score = 28.7 bits (61), Expect = 6.8 Identities = 11/28 (39%), Positives = 12/28 (42%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PP +PP PPP P P PP Sbjct: 78 PPPPSPPSSSPPPLSFPPPPPPPSSPPP 105 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP P P PPP P PP Sbjct: 78 PPPPSPPSSSPPPLSFPPPPPPPSSPPPP 106 >01_01_0975 - 7686297-7686458,7687117-7687245,7687754-7687831, 7688011-7688469,7690648-7690788,7691771-7692421 Length = 539 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/54 (33%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPP--XXGGSXXTXFSSXSXXXPPPXPXA 915 P G PP A PPP P P PP G + + PPP P A Sbjct: 322 PTIGFPPPHAA-AMVPPPPHPPPFCRPPLHVWGHPTAGVEPTTAAAPPPPSPHA 374 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/45 (28%), Positives = 15/45 (33%) Frame = +1 Query: 775 PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P P P P PP G + + PPP P Sbjct: 113 PPPPPHLLHYYGHPPPPPPPPPPFKGDHYGGVYQNWQQNGPPPPP 157 >12_02_0848 + 23636478-23638058 Length = 526 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P P TPP P PPP P PP G Sbjct: 51 PAVTLPVQRAGDTPPPPPIIDASPPPPSTSPPPPPPRRG 89 >11_04_0009 - 12132781-12133272 Length = 163 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -1 Query: 219 RSSTWAREQRWSCSKPAPERRRRIGSLR 136 R W RE+R S + P +RRR+G R Sbjct: 108 RGEAWRRERRDSKIESRPSQRRRVGGRR 135 >10_08_0520 - 18495118-18498237 Length = 1039 Score = 28.3 bits (60), Expect = 9.0 Identities = 13/30 (43%), Positives = 14/30 (46%), Gaps = 3/30 (10%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAK---TXXXPPP 816 P A P PPP PP PA+ PPP Sbjct: 88 PAAPPPPPPPSAQPPARPARYDFLNSKPPP 117 >10_07_0188 + 13921731-13921938,13922076-13922338,13922463-13923257 Length = 421 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +1 Query: 787 PAKTXXXPPPXPXPXXX-PPXXGGSXXTXFSSXSXXXPPPXPXA 915 P PP P P PP GS ++S PPP P A Sbjct: 228 PYDVAAAPPTAPWPVCWAPPSAPGSYDCCYASTFSRPPPPPPIA 271 >09_02_0369 - 8012470-8013120 Length = 216 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 5/36 (13%) Frame = +1 Query: 751 PXPPPXGTPPXXPAK-----TXXXPPPXPXPXXXPP 843 P PPP PP P T PPP P PP Sbjct: 40 PPPPPHDDPPLKPPPQQQFITAQPPPPDEPPLKPPP 75 >08_02_1084 - 24232968-24234779 Length = 603 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/58 (27%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP PP + PPP P P PP ++ + PP P Sbjct: 74 PSQQLPPPPQQQQPPPQHS----LPPPPPLPQAPPPQQQKVHIPGVAAPAPNHPPSQP 127 >08_02_0758 + 20848078-20849579,20849660-20849850,20849944-20850179, 20850254-20850973 Length = 882 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 G P P PP PP + PPP P Sbjct: 424 GIPKPAPPPPPQKNPPPNLKGQCYGQPPPPP 454 >08_01_0134 + 1067826-1068158 Length = 110 Score = 28.3 bits (60), Expect = 9.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +1 Query: 775 PPXXPAKTXXXPPPXPXPXXXPP 843 PP P+ PPP P P PP Sbjct: 2 PPPLPSSRPPPPPPLPRPHPAPP 24 >06_03_1368 - 29612463-29612638,29613135-29613222,29613334-29613474, 29613561-29613595,29613990-29614054,29614286-29614335, 29614417-29614521,29614608-29614688,29614771-29614852, 29614941-29614995,29615111-29616164,29617202-29617289, 29617379-29617485,29617568-29617686,29617784-29617994 Length = 818 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P PPP P T PPP P Sbjct: 6 PHLPPPAPPPGAAAADPPESTPAPPPPPP 34 >06_03_1326 - 29355467-29355817 Length = 116 Score = 28.3 bits (60), Expect = 9.0 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 10 GGGKGGGGGGGGGKGGGGGSGGGGRSGGGGG 40 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 28.3 bits (60), Expect = 9.0 Identities = 17/54 (31%), Positives = 20/54 (37%), Gaps = 3/54 (5%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP---XPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PPP +PP P PPP P P P S + + PPP Sbjct: 583 PSPPPLRSPPRQPT-----PPPSPSQQPPLPTPQPVQASPTSPTKQHAPPAPPP 631 >05_07_0100 + 27679280-27680320 Length = 346 Score = 28.3 bits (60), Expect = 9.0 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP P P+ P P P P PP Sbjct: 150 PPPYFAMPIHPSAVRKPPSPSPSPSPPPP 178 >04_03_0804 - 19844059-19844777,19844914-19844995,19846580-19846585 Length = 268 Score = 28.3 bits (60), Expect = 9.0 Identities = 15/53 (28%), Positives = 15/53 (28%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P P P PPP P PP G PPP P Sbjct: 170 PVPYPYAGQWCCPKPEPPKPPPEPPKEPEPPKPCGCSHAFVCVCKPAPPPPPP 222 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P A P P PP P T PPP P Sbjct: 40 PPARHRAPSPPRPPPPPPPPTQPAPPPPP 68 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P PPP P P K P P P P P Sbjct: 231 PPPPPKQEPCPPPPKVVEVPYPWPYPYPFP 260 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/51 (31%), Positives = 17/51 (33%), Gaps = 1/51 (1%) Frame = +1 Query: 760 PPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG-GSXXTXFSSXSXXXPPPXP 909 PP G PPP P P PP S +S S P P P Sbjct: 66 PPAGIAVHPSPPPPPPPPPPPPPVPVPPAYSVTSSVPPYSMTSSLPPSPRP 116 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,276,112 Number of Sequences: 37544 Number of extensions: 547829 Number of successful extensions: 6574 Number of sequences better than 10.0: 139 Number of HSP's better than 10.0 without gapping: 1806 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4342 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2600672280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -