BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N04 (915 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.004 SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) 40 0.004 SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) 40 0.004 SB_33909| Best HMM Match : FH2 (HMM E-Value=0) 38 0.011 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 0.035 SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) 36 0.046 SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) 36 0.060 SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) 35 0.080 SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) 35 0.080 SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) 35 0.080 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 34 0.14 SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) 33 0.24 SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) 33 0.32 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) 32 0.56 SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) 32 0.74 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.74 SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) 31 1.3 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 31 1.3 SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) 31 1.3 SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) 31 1.3 SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) 31 1.7 SB_59302| Best HMM Match : Collagen (HMM E-Value=0) 30 2.3 SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) 30 2.3 SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) 30 2.3 SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) 30 2.3 SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) 30 2.3 SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) 30 3.0 SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) 30 3.0 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 3.0 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 30 3.0 SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) 30 3.0 SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 29 4.0 SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) 29 4.0 SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) 29 4.0 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 29 4.0 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) 29 5.2 SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_29559| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 29 5.2 SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) 29 6.9 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) 28 9.2 SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_2320| Best HMM Match : TFIID_20kDa (HMM E-Value=2.2) 28 9.2 SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) 28 9.2 SB_29257| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 41.9 bits (94), Expect = 7e-04 Identities = 33/131 (25%), Positives = 36/131 (27%) Frame = +2 Query: 518 NSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXS 697 N P PPP PP P +P P P P P P + Sbjct: 87 NFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPNPPYPPPPNAPYPPSPNA 146 Query: 698 XVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFP 877 P+ L P P P P P P PP P P PP P P Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPP--PNAPYPPPPYPPPPNPPYP--PPPNPPYPPPPNAP 202 Query: 878 XXXXXXPPXXP 910 PP P Sbjct: 203 NPPPPNPPYPP 213 Score = 41.5 bits (93), Expect = 0.001 Identities = 36/133 (27%), Positives = 40/133 (30%), Gaps = 3/133 (2%) Frame = +2 Query: 521 SXXXPXXPPPXPXXXXXXP--PXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 S P PPP P P P P P P+ + PP P A P P Sbjct: 89 SPNPPYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPPN--PPYPPPPNAPYP-PSPN 145 Query: 695 SXVXXXXXGPFXXXLXRXXPGPXP-RAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPG 871 + P+ L P P P AP P P P P P P A P Sbjct: 146 APYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPP 205 Query: 872 FPXXXXXXPPXXP 910 P PP P Sbjct: 206 PPNPPYPPPPNAP 218 Score = 38.7 bits (86), Expect = 0.006 Identities = 28/106 (26%), Positives = 30/106 (28%), Gaps = 2/106 (1%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P PL+ PP P P PP Sbjct: 131 PYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPPP 190 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP--XPXPXXXPP 843 + P A P PP PP A PPP P P PP Sbjct: 191 PNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPP 236 Score = 37.5 bits (83), Expect = 0.015 Identities = 31/126 (24%), Positives = 34/126 (26%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PPP P PP P P P + PP P PPP + Sbjct: 114 PPYPPP-PNAPYPPPPNPPYPPPPNAPYPPSPNAPYPPPPNP-PYPPPLYPPPPNP--PP 169 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXX 892 P+ P P P P P P P PP P P Sbjct: 170 PNAPYPPPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPNAP 229 Query: 893 XPPXXP 910 PP P Sbjct: 230 NPPYPP 235 Score = 33.5 bits (73), Expect = 0.24 Identities = 25/99 (25%), Positives = 25/99 (25%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P P P PP P P PP Sbjct: 147 PYPPPPNPPYPPPLYPPPPNPPPPNAPYP--------PPPYPPPPNPPYPPPPNPPYPPP 198 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P PP PP P PP P P Sbjct: 199 PNAPNPPPPNPPYPPPPNAPNPPYPPPPNAPNPPYPPPP 237 Score = 31.9 bits (69), Expect = 0.74 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PP PP P PPP P P PP S + PPP P Sbjct: 101 PYPPPPPYPPPPNPPYPPPPNAPYPPP-PNPPYPPPPNAPYPP---SPNAPYPPPPNP 154 Score = 30.3 bits (65), Expect = 2.3 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PP PP P PPP P PP Sbjct: 93 PYPPPPYPPYPPPPPYPPPPNPPYPPPPNAPYPPPP 128 Score = 29.1 bits (62), Expect = 5.2 Identities = 29/127 (22%), Positives = 32/127 (25%), Gaps = 1/127 (0%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLF-SRGFLXPPXXXPXXXXPSXXPPXXXRXX 708 P PPP P P +P P S PP P P PP Sbjct: 115 PYPPPPNAPYPPP----PNPPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPP 170 Query: 709 XQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSX 888 P P PP PP P P P P P + + Sbjct: 171 NAPYP---PPPYPPPPNPPYPPPPNPPYPPPPNAPNPPPPNPPYPPPPNAPNPPYPPPPN 227 Query: 889 XXPPPXP 909 PP P Sbjct: 228 APNPPYP 234 Score = 28.7 bits (61), Expect = 6.9 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 G P PP PP P PP P P PP Sbjct: 82 GHPPTNFSPNPPYPPPPYPPYPPPPPYPPPPNPPYPPP 119 >SB_9896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 A P PPP G P PA PP P P PP GG Sbjct: 176 AAPPAPPPPGAPAAPPAPPFGGPPSAPPPPPAPPVGGG 213 >SB_55818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 39.9 bits (89), Expect = 0.003 Identities = 22/69 (31%), Positives = 24/69 (34%) Frame = +1 Query: 616 PLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAK 795 P F PP P P+ PP P A P PPP PP PA+ Sbjct: 43 PHFISSSPPPPPPSPPAAAPAAPPPPAAAPAAPPPP--AAPPAAPPPPPPLPAPPPPPAQ 100 Query: 796 TXXXPPPXP 822 PPP P Sbjct: 101 PAPQPPPAP 109 Score = 31.5 bits (68), Expect = 0.98 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P A PPP PP P PPP P P PP Sbjct: 68 PAAAPAAPPPPAAPPAAP------PPPPPLPAPPPP 97 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/62 (29%), Positives = 18/62 (29%) Frame = +1 Query: 724 FXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 F P PPP PP PA PPP PP PPP Sbjct: 39 FTYYPHFISSSPPP--PPPSPPAAAPAAPPPPAAAPAAPPPPAAPPAAPPPPPPLPAPPP 96 Query: 904 XP 909 P Sbjct: 97 PP 98 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/33 (39%), Positives = 13/33 (39%), Gaps = 2/33 (6%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPP--PXPXPXXXPP 843 P PP PP P PP P P P PP Sbjct: 78 PAAPPAAPPPPPPLPAPPPPPAQPAPQPPPAPP 110 >SB_11023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 669 Score = 39.9 bits (89), Expect = 0.003 Identities = 23/70 (32%), Positives = 24/70 (34%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P PP + G P P PPP PP P T PPP P Sbjct: 354 PPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPP----PPPPPTNGPPPPPPPTNGPPPPPP 409 Query: 823 XPXXXPPXXG 852 P PP G Sbjct: 410 -PTNGPPSEG 418 Score = 39.5 bits (88), Expect = 0.004 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P T PPP P PP + PPP P Sbjct: 346 PPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Score = 36.3 bits (80), Expect = 0.035 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 2/53 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPX--PXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP TPP P PPP P P PP G + PPP Sbjct: 357 PPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPPPPTNGPPPPPP 409 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/62 (30%), Positives = 20/62 (32%), Gaps = 4/62 (6%) Frame = +3 Query: 738 SGGG----PXAPXXGHPSXPXXKNPXXPPXXXXSXXXSPPXGGXXXXXVFLXLXXXPPPX 905 SGGG P P PS P N PP + PP PPP Sbjct: 339 SGGGGVNPPPPPTNNPPSPPPPTNNTPPPPPPTNKPPPPPPPTNGPPPPPPPTNGPPPPP 398 Query: 906 PP 911 PP Sbjct: 399 PP 400 >SB_40518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1000 Score = 39.5 bits (88), Expect = 0.004 Identities = 20/57 (35%), Positives = 21/57 (36%), Gaps = 1/57 (1%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXX-PPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 A P PPP G+ P P PPP P P P GG PPP P Sbjct: 930 APLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPPPGGSAPPPPP 986 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/77 (29%), Positives = 24/77 (31%), Gaps = 6/77 (7%) Frame = +1 Query: 631 GFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGX------PXAXXPXPPPXGTPPXXPA 792 G + PP P P PP Q G P PP G PP P Sbjct: 917 GSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNAPPPPPPPGGSAPPPGGGAPPLPPP 976 Query: 793 KTXXXPPPXPXPXXXPP 843 PPP P P PP Sbjct: 977 PGGSAPPPPPPPPPPPP 993 Score = 30.7 bits (66), Expect = 1.7 Identities = 27/106 (25%), Positives = 29/106 (27%), Gaps = 1/106 (0%) Frame = +1 Query: 595 FPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGT 774 FP P + G P P PP G P PP Sbjct: 893 FPRRNESPSQTPGGSESPSASPPGGSVPPPPPPPGGNAPLPPPPPGGSAPSQPPPPGGNA 952 Query: 775 PPXXPAKTXXXPPPXPX-PXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P PPP P PP G S+ PPP P Sbjct: 953 PPPPPPPGGSAPPPGGGAPPLPPPPGG-------SAPPPPPPPPPP 991 >SB_12366| Best HMM Match : SRCR (HMM E-Value=4.4e-33) Length = 457 Score = 39.5 bits (88), Expect = 0.004 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P P PPP PP P PPP P P PP PPP P Sbjct: 367 PPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPP 424 Score = 38.7 bits (86), Expect = 0.006 Identities = 21/62 (33%), Positives = 21/62 (33%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP Q P P PPP PP PA PPP P Sbjct: 371 PPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPP-PPPPPPAPPPPPPPPPP 429 Query: 823 XP 828 P Sbjct: 430 PP 431 Score = 38.7 bits (86), Expect = 0.006 Identities = 20/60 (33%), Positives = 21/60 (35%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P P PPP +PP P PPP P P PP PPP P A Sbjct: 376 PSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPP--PPPPPAPPPPPPPPPPPPPA 433 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP +PP P PPP P P PP Sbjct: 365 PPPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPP 400 Score = 35.1 bits (77), Expect = 0.080 Identities = 19/60 (31%), Positives = 20/60 (33%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 G + P PPP PP P PPP P P PP PPP P Sbjct: 360 GINMSPPPPPPPP-PPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 34.3 bits (75), Expect = 0.14 Identities = 21/75 (28%), Positives = 21/75 (28%) Frame = +2 Query: 644 PPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXP 823 PP P PPP P P P P P P P PP P Sbjct: 366 PPPPPPPPPPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPP 425 Query: 824 XPLXXPPXXGXAXXP 868 P PP A P Sbjct: 426 PPPPPPPALRLACAP 440 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P P P P P PP P P PP P P PP P Sbjct: 374 PPPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPAPPPPPPP 426 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/72 (27%), Positives = 23/72 (31%) Frame = +2 Query: 629 GVSWXPPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXP 808 G++ PP P PPP P + P P P P P P P Sbjct: 360 GINMSPPPPPPPPPPPPSPPPPPPPPPPSPPP----PPQPPPPPPPPPPPPPPPPPPPPP 415 Query: 809 PXXXPXPLXXPP 844 P P P PP Sbjct: 416 PPPAPPPPPPPP 427 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/67 (31%), Positives = 22/67 (32%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP + P P PPP PP P PPP P Sbjct: 375 PPSPPPPPPPPPPSPPPPPQPPPPPPPPPPPPPPPPPPPPP---PPPAP------PPPPP 425 Query: 823 XPXXXPP 843 P PP Sbjct: 426 PPPPPPP 432 Score = 30.3 bits (65), Expect = 2.3 Identities = 18/59 (30%), Positives = 19/59 (32%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 +N P PPP P PP P SP P PP P PPP Sbjct: 361 INMSPPPPPPPPPPPPSPPPPPPPPPPSPPPPPQP-------PPPPPPPPPPPPPPPPP 412 Score = 29.1 bits (62), Expect = 5.2 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPP 816 PP P P PP P A P PPP PP PA PP Sbjct: 386 PPSPPPPPQPPPPPPPPPPPPPPPPPPPPPPPPA--PPPPPPPPPPPPPALRLACAPP 441 >SB_2012| Best HMM Match : Extensin_2 (HMM E-Value=0.1) Length = 305 Score = 39.5 bits (88), Expect = 0.004 Identities = 29/107 (27%), Positives = 29/107 (27%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P G P PP P P PP Sbjct: 124 PSPPPPPTSPATRAPPPPPPIAPATGGPP-------PPPPIAPATGGPPPPPPIAPAATV 176 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P A PPP G PP P PPP PP G Sbjct: 177 PAP---AVPLAAASPPPPSGGPPPPPPPPPPPPPPPILELAAPPPPG 220 Score = 31.5 bits (68), Expect = 0.98 Identities = 18/61 (29%), Positives = 22/61 (36%), Gaps = 8/61 (13%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPP--------XPXPXXXPPXXGGSXXTXFSSXSXXXPPPX 906 P PPP P P++ PPP P P P GG + + PPP Sbjct: 108 PTPPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPP 167 Query: 907 P 909 P Sbjct: 168 P 168 Score = 31.5 bits (68), Expect = 0.98 Identities = 21/89 (23%), Positives = 24/89 (26%) Frame = +2 Query: 644 PPXXXXPXAXXXXPPPXSXVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXP 823 PP + PPP P + GP P P+ P P PP P Sbjct: 113 PPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGPPPPPPIAPATGGPPPPPPIAP 172 Query: 824 XPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P A P PP P Sbjct: 173 AATVPAPAVPLAAASPPPPSGGPPPPPPP 201 Score = 30.7 bits (66), Expect = 1.7 Identities = 20/55 (36%), Positives = 22/55 (40%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P PPP PP PA T PPP P P G + + PPP P A Sbjct: 124 PSPPP---PPTSPA-TRAPPPPPPIA---PATGGPPPPPPIAPATGGPPPPPPIA 171 Score = 29.5 bits (63), Expect = 4.0 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P PRAP P PP P PP A G P PP P Sbjct: 110 PPPPPRAPETPSQAPSPPPPPTSPATRAPPPPPPIAPATGGP---PPPPPIAP 159 >SB_33909| Best HMM Match : FH2 (HMM E-Value=0) Length = 1063 Score = 37.9 bits (84), Expect = 0.011 Identities = 24/89 (26%), Positives = 27/89 (30%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PPP P PP P PG G P PP P PPP + Sbjct: 712 PPPPPPPPPGCAGLPPPPPSPQPGCAGLP--------PPPPPPPPGCAGLPPPPPPIDVP 763 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKP 799 F + P P P L +P Sbjct: 764 MKPLFWKRIQLKKPQPEPYTTLWENLIEP 792 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/55 (30%), Positives = 18/55 (32%), Gaps = 2/55 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXP--PXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP PPP P P P S + PPP P Sbjct: 694 PPPPPPPPPPLLSGTLPMPPPPPPPPPGCAGLPPPPPSPQPGCAGLPPPPPPPPP 748 Score = 29.9 bits (64), Expect = 3.0 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 P PPP PP P PG G P PP P PPP Sbjct: 698 PPPPPPLLSGTLPMPPPPPPPPPGCAGLP-------PPPPSPQPGCAGLPPPP 743 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 36.3 bits (80), Expect = 0.035 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP PP P PPP P P PP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPFPPPPPP 494 Score = 34.7 bits (76), Expect = 0.11 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 G A P PPP PP P PPP P P P Sbjct: 459 GVGQAPPPPPPPPPPPPPPPPPPPPPPPPFPPPPPPTP 496 >SB_37803| Best HMM Match : WH2 (HMM E-Value=1.8e-10) Length = 514 Score = 35.9 bits (79), Expect = 0.046 Identities = 27/95 (28%), Positives = 29/95 (30%) Frame = +1 Query: 625 SRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXX 804 SRG PP P + PP R + P P PP G P Sbjct: 310 SRGSAPPPP--PARMGTAPPPPPPSRSSQRPPP----PSRGAPPPPSMGMAPPPVGGAAP 363 Query: 805 XPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PPP P PP SS PPP P Sbjct: 364 PPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPP 398 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/53 (30%), Positives = 19/53 (35%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PP G PP P++ PPP PP S + PP P Sbjct: 297 PPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSRGAPPPP 349 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/53 (32%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPP--XPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP G P P++ PPP P P G + S S PPP Sbjct: 288 PPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPP 340 Score = 29.9 bits (64), Expect = 3.0 Identities = 30/124 (24%), Positives = 33/124 (26%), Gaps = 2/124 (1%) Frame = +2 Query: 545 PPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXX-- 718 PP P PP P +P P G + PP A PP S Sbjct: 287 PPPPPSRGAAPPPPSRGAPPP---PPSRGSAPPPPPARMGTAPPPPPPSRSSQRPPPPSR 343 Query: 719 GPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXP 898 G P P A P P P P P+ P P P P Sbjct: 344 GAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAP 403 Query: 899 PXXP 910 P P Sbjct: 404 PPGP 407 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/45 (28%), Positives = 17/45 (37%) Frame = +1 Query: 775 PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 PP P++ PPP PP G + + PPP P Sbjct: 287 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPPPPARMGTAPPPPPP 331 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 2/31 (6%) Frame = +1 Query: 736 PXAXXPXPPPX--GTPPXXPAKTXXXPPPXP 822 P P PPP PP PA+ PPP P Sbjct: 300 PSRGAPPPPPSRGSAPPPPPARMGTAPPPPP 330 Score = 29.9 bits (64), Expect = 3.0 Identities = 27/106 (25%), Positives = 28/106 (26%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P R P G PP P + PPP Sbjct: 315 PPPPPARMGTAPPPPPPSRSSQRPPPPSRGA---PP----PPSMGMAPPPVGGAAPPPPP 367 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXA 859 P P P P P PP P P G A Sbjct: 368 PPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPGPMIPGRA 413 Score = 29.9 bits (64), Expect = 3.0 Identities = 24/80 (30%), Positives = 25/80 (31%), Gaps = 3/80 (3%) Frame = +3 Query: 684 PPPXPPXXXTXXXLXRXXSGGGPXAPXXGHPSXPXX---KNPXXPPXXXXSXXXSPPXGG 854 PPP PP + S G P P G P P PP PP G Sbjct: 326 PPPPPPSRSSQRP--PPPSRGAPPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPPPPPIEG 383 Query: 855 XXXXXVFLXLXXXPPPXPPG 914 L PPP PPG Sbjct: 384 RPPSS----LGNPPPPPPPG 399 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/34 (38%), Positives = 13/34 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 P PPP G PP P PP PP G Sbjct: 366 PPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPG 399 Score = 28.7 bits (61), Expect = 6.9 Identities = 28/110 (25%), Positives = 30/110 (27%) Frame = +2 Query: 542 PPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXG 721 PPP P PP P P S PP P + PPP + Sbjct: 305 PPPPPSRGSAPPPPPARMGTAPPPPPPSRS-SQRPP----PPSRGAPPPPSMGMAPP--- 356 Query: 722 PFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPG 871 P P P P P PP P PP A PG Sbjct: 357 PVGGAAPPPPPPPPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPPG 406 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/36 (33%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP P+ PPP P PP Sbjct: 369 PPVGGPPPPPPPIEGRPPSSLGNPPPPPPPGRGAPP 404 >SB_20442| Best HMM Match : Chitin_bind_3 (HMM E-Value=7.4e-05) Length = 288 Score = 35.5 bits (78), Expect = 0.060 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P A P PP G PP P T PPP P PP Sbjct: 213 PTAAPPPPPTTGAPPPTPV-TNKPPPPRPATTQAPP 247 >SB_39784| Best HMM Match : WH2 (HMM E-Value=2e-05) Length = 480 Score = 35.1 bits (77), Expect = 0.080 Identities = 32/131 (24%), Positives = 34/131 (25%), Gaps = 5/131 (3%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGX-----RGXPFFXGVSWXPPXXXXPXAXXXXPPPXS 697 P PP P PP P P +G P P A PPP Sbjct: 266 PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSR 325 Query: 698 XVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFP 877 P + P P P P PP P PL PP P P Sbjct: 326 DQVPLPPPPLRGQIA--PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP--P 381 Query: 878 XXXXXXPPXXP 910 PP P Sbjct: 382 SGKINPPPPPP 392 Score = 32.7 bits (71), Expect = 0.43 Identities = 32/122 (26%), Positives = 34/122 (27%), Gaps = 1/122 (0%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P RG PP P+ PP Sbjct: 250 PPPPMRGPTSGGEPP----PPKNAPPPPKRGSSNPPPP------PTRGPPSNSFTTQGPP 299 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXP-PPXPXPXXXPPXXGGSXXTXFSSXSXXXP 897 A P PP TPP P P PP P P S+ S P Sbjct: 300 LPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 359 Query: 898 PP 903 PP Sbjct: 360 PP 361 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPA------KTXXXPPPXPXPXXXPPXXGGSXXTXFSS-XSXXX 894 P PPP G PP K P P P PP G+ T +S S Sbjct: 134 PPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNG 193 Query: 895 PPPXP 909 PPP P Sbjct: 194 PPPPP 198 Score = 29.1 bits (62), Expect = 5.2 Identities = 29/108 (26%), Positives = 31/108 (28%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P PL RG + PP P PP R Sbjct: 308 PAPPPPLNATPPPPP--PSRDQVPLPPPPL--RGQIAPPPP------PISKPPTSTRSAP 357 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P PPP G P P+ PPP P P G Sbjct: 358 PPPPGRAPQPLGGPPPPPPGRRP--PSGKINPPPPPPPAMDKPSFTNG 403 Score = 28.7 bits (61), Expect = 6.9 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 4/110 (3%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P SR PP P PP R Q Sbjct: 175 PPPSGNKPTFGNSRTSTNGPPP---PPHSRHGSAPP---PPERSSGPPPPPPGRGPSQRS 228 Query: 721 XFXGXPXAXXPXP-PPXGT---PPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 + P P PP G PP T PP P PP G S Sbjct: 229 LAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSS 278 >SB_19504| Best HMM Match : FH2 (HMM E-Value=1.2e-30) Length = 739 Score = 35.1 bits (77), Expect = 0.080 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P A P PPP PP P PPP P P PP Sbjct: 190 PMAGMPPPPPPPPPPGFPG---GAPPPPPPPFGAPP 222 >SB_10535| Best HMM Match : Extensin_2 (HMM E-Value=0.013) Length = 392 Score = 35.1 bits (77), Expect = 0.080 Identities = 32/131 (24%), Positives = 34/131 (25%), Gaps = 5/131 (3%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGX-----RGXPFFXGVSWXPPXXXXPXAXXXXPPPXS 697 P PP P PP P P +G P P A PPP Sbjct: 178 PKNAPPPPKRGSSNPPPPPTRGPPSNSFTTQGPPLPPSRDQAPAPPPPLNATPPPPPPSR 237 Query: 698 XVXXXXXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFP 877 P + P P P P PP P PL PP P P Sbjct: 238 DQVPLPPPPLRGQIA--PPPPPISKPPTSTRSAPPPPPGRAPQPLGGPPPPPPGRRP--P 293 Query: 878 XXXXXXPPXXP 910 PP P Sbjct: 294 SGKINPPPPPP 304 Score = 32.7 bits (71), Expect = 0.43 Identities = 32/122 (26%), Positives = 34/122 (27%), Gaps = 1/122 (0%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P P RG PP P+ PP Sbjct: 162 PPPPMRGPTSGGEPP----PPKNAPPPPKRGSSNPPPP------PTRGPPSNSFTTQGPP 211 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXP-PPXPXPXXXPPXXGGSXXTXFSSXSXXXP 897 A P PP TPP P P PP P P S+ S P Sbjct: 212 LPPSRDQAPAPPPPLNATPPPPPPSRDQVPLPPPPLRGQIAPPPPPISKPPTSTRSAPPP 271 Query: 898 PP 903 PP Sbjct: 272 PP 273 Score = 31.1 bits (67), Expect = 1.3 Identities = 21/65 (32%), Positives = 23/65 (35%), Gaps = 7/65 (10%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPA------KTXXXPPPXPXPXXXPPXXGGSXXTXFSS-XSXXX 894 P PPP G PP K P P P PP G+ T +S S Sbjct: 46 PPKNSSPPPPFGAPPPPDRGGQLAKKPSQGSFPPPPPMGKPPPPSGNKPTFGNSRTSTNG 105 Query: 895 PPPXP 909 PPP P Sbjct: 106 PPPPP 110 Score = 29.1 bits (62), Expect = 5.2 Identities = 29/108 (26%), Positives = 31/108 (28%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PPP P P PL RG + PP P PP R Sbjct: 220 PAPPPPLNATPPPPP--PSRDQVPLPPPPL--RGQIAPPPP------PISKPPTSTRSAP 269 Query: 712 QXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 P PPP G P P+ PPP P P G Sbjct: 270 PPPPGRAPQPLGGPPPPPPGRRP--PSGKINPPPPPPPAMDKPSFTNG 315 Score = 28.7 bits (61), Expect = 6.9 Identities = 30/110 (27%), Positives = 31/110 (28%), Gaps = 4/110 (3%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P P SR PP P PP R Q Sbjct: 87 PPPSGNKPTFGNSRTSTNGPPP---PPHSRHGSAPP---PPERSSGPPPPPPGRGPSQRS 140 Query: 721 XFXGXPXAXXPXP-PPXGT---PPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 + P P PP G PP T PP P PP G S Sbjct: 141 LAPPPTGSSRPLPAPPPGENRPPPPMRGPTSGGEPPPPKNAPPPPKRGSS 190 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 34.3 bits (75), Expect = 0.14 Identities = 19/58 (32%), Positives = 22/58 (37%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP P+ PPP P P PP S ++ PPP P Sbjct: 198 PSQITQPPPPPPRPP--PSPPPPPPPPSPSPPRPPPPPPPSPPRPLAA-KLPEPPPIP 252 Score = 28.3 bits (60), Expect = 9.2 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 4/60 (6%) Frame = +1 Query: 685 PPXXXRXXXQXXXFXGXPXAXX--PXPPPXGTPPXXPAKTXXXPPPXP--XPXXXPPXXG 852 PP R P P PPP +PP A PPP P P PP G Sbjct: 205 PPPPPRPPPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPTLPPPTLG 264 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFPXXXXXXPPXXP 910 P P P P P P PP P P PP A P P PP P Sbjct: 209 PRPPPSPPPPPPPPSPS-PPRPPPPPPPSPPRPLAAKLPE-PPPIPNMPPTLP 259 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/53 (30%), Positives = 17/53 (32%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 P PPP P PP P P P + PP P PPP Sbjct: 212 PPSPPPPPPPPSPSPPRPPPPPPPSPPRPLAAKLPEPPPIPNMPPT---LPPP 261 >SB_55393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1597 Score = 33.9 bits (74), Expect = 0.18 Identities = 20/61 (32%), Positives = 21/61 (34%), Gaps = 3/61 (4%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXP---PPX 906 P P PPP PP P + PPP P GS S S P PP Sbjct: 684 PPPPPPPPPPPPPPPPPPQPSTPPPPPPSTPPVQQSGAPGSPAGSPSGTSAGNPQQQPPP 743 Query: 907 P 909 P Sbjct: 744 P 744 >SB_34481| Best HMM Match : Extensin_2 (HMM E-Value=0.48) Length = 341 Score = 33.5 bits (73), Expect = 0.24 Identities = 16/38 (42%), Positives = 16/38 (42%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 G A P PPP G PP P PPP P PP Sbjct: 299 GSAPAPPPPPPPGGAPPPPP----PPPPPPPGDGGAPP 332 Score = 33.1 bits (72), Expect = 0.32 Identities = 15/38 (39%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXX--PPPXPXPXXXPPXXGGS 858 P PP G+ P P PPP P P PP GG+ Sbjct: 293 PPPPADGSAPAPPPPPPPGGAPPPPPPPPPPPPGDGGA 330 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXP 828 PPP PP P PPP P P Sbjct: 314 PPPPPPPPPPPPGDGGAPPPPPPP 337 >SB_41910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1486 Score = 33.1 bits (72), Expect = 0.32 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP PP P K PPP P PP Sbjct: 1236 PPPPAMPPDGPPKFMGLPPPPPGMRPMPP 1264 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 G P PPP G P P PPP P P G Sbjct: 1245 GPPKFMGLPPPPPGMRPMPPQPPFMPPPPRMQPPGPPGPPG 1285 >SB_39302| Best HMM Match : SH3_2 (HMM E-Value=1.9e-38) Length = 2084 Score = 33.1 bits (72), Expect = 0.32 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP 822 P PPP PP PA+ PPP P Sbjct: 512 PPPPPASPPPPLPAEEDNSPPPLP 535 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP 828 P PPP PP P+ PPP P P Sbjct: 1159 PPPPPPPPPPSSPSPPPPPPPPPPPP 1184 Score = 32.3 bits (70), Expect = 0.56 Identities = 14/49 (28%), Positives = 19/49 (38%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXP 897 P PPP PP + + PPP P P P + T + + P Sbjct: 1157 PPPPPPPPPPPPSSPSPPPPPPPPPPPPTPTTTTTTTTTTITKTTRITP 1205 Score = 29.1 bits (62), Expect = 5.2 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 P P PPP +P P PPP P Sbjct: 1158 PPPPPPPPPPPSSPSPPPPPPPPPPPPTP 1186 >SB_52556| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 32.3 bits (70), Expect = 0.56 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P P PPP P P PPP P P P Sbjct: 218 PDYLEPTPPPPAAPAPPPPPAAAPPPPPPPPPVKKP 253 >SB_28644| Best HMM Match : zf-CCCH (HMM E-Value=1.5e-05) Length = 267 Score = 32.3 bits (70), Expect = 0.56 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG GGG G G Sbjct: 85 GGFGGGGGFGGGGGGGFGGGGGGGFGGGGGGGGGFG 120 Score = 28.7 bits (61), Expect = 6.9 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG + G GG GGG G Sbjct: 95 GGGGGGFGGGGGGGFGGGGGGGGGFGGGGGG 125 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG F G GG GGG G G Sbjct: 81 GGRGGGFGGGGG----FGGGGGGGFGGGGGGGFGGG 112 >SB_23015| Best HMM Match : WW (HMM E-Value=2.8e-16) Length = 678 Score = 31.9 bits (69), Expect = 0.74 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 5/39 (12%) Frame = +1 Query: 751 PXPPPXGT---PPXXPAKTXXXPPPXPXP--XXXPPXXG 852 P PPP G PP P++ PPP P P PP G Sbjct: 554 PPPPPPGVDIPPPLPPSEDPKPPPPPPEPPEECPPPPPG 592 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.9 bits (69), Expect = 0.74 Identities = 25/88 (28%), Positives = 28/88 (31%), Gaps = 3/88 (3%) Frame = +1 Query: 598 PXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTP 777 P P+ S + PP P PS P G P + PPP G P Sbjct: 2136 PAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSVPPPM--GAPPSG---PPPMGAP 2190 Query: 778 PXXPAKTXXXP---PPXPXPXXXPPXXG 852 P P P PP P PP G Sbjct: 2191 PSGPPPMGTPPSGHPPMGAPPMGPPPSG 2218 Score = 28.7 bits (61), Expect = 6.9 Identities = 25/99 (25%), Positives = 26/99 (26%), Gaps = 1/99 (1%) Frame = +1 Query: 610 GXPLFSRGFLXPPXXX-PXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXX 786 G P R PP P+ PP G P P G PP Sbjct: 2114 GPPSMGRYNTPPPMGQYGAPARPAMGPPPMGSSRYGPPPPMGPARHSPSGPSPLGAPPSV 2173 Query: 787 PAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P PP P P PP T S PP Sbjct: 2174 PPPMGA-PPSGPPPMGAPPSGPPPMGTPPSGHPPMGAPP 2211 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 31.9 bits (69), Expect = 0.74 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PP PP PA PP P P PP Sbjct: 951 PPPPTSALPPPIPATQVPPPPLPPLPPPPPP 981 Score = 28.3 bits (60), Expect = 9.2 Identities = 17/56 (30%), Positives = 19/56 (33%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 P P PPP P P PPP P P + T S+ PPP Sbjct: 901 PKPTTPAPPPP--LPLAPEPPPPLPPPPPPIQTTRPTVPTTPTTQASTTRPTPPPP 954 >SB_32600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1572 Score = 31.5 bits (68), Expect = 0.98 Identities = 20/59 (33%), Positives = 21/59 (35%), Gaps = 1/59 (1%) Frame = +1 Query: 736 PXAXXPXPPPXGTP-PXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P A P PP GTP P P PP P P PP + PPP P Sbjct: 574 PGAPHPRVPPPGTPHPRVP------PPGAPHPKVPPPGAPYQRLPYSGAYHPRLPPPGP 626 >SB_20869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1212 Score = 31.5 bits (68), Expect = 0.98 Identities = 28/111 (25%), Positives = 30/111 (27%) Frame = +2 Query: 545 PPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXGP 724 PP P P PG P PP PP S V P Sbjct: 1002 PPRQHTQCSIDPVPHLKPPGPTEQPVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPP--P 1059 Query: 725 FXXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXPGFP 877 P P PR P P +P PP P P+ P P P Sbjct: 1060 RKPSPPPSEPAPPPRQPPPPSTSQP-VPPPRQPDPIPTNPAHPTEPPPRQP 1109 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/37 (37%), Positives = 14/37 (37%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXP-PPXPXPXXXPP 843 P P PPP P P K P P P P PP Sbjct: 1042 PPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQPPP 1078 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/38 (36%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +1 Query: 736 PXAXXPXPPPX--GTPPXXPAKTXXXPPPXPXPXXXPP 843 P + P PPP PP PA PPP PP Sbjct: 1050 PPSAVPIPPPRKPSPPPSEPAPPPRQPPPPSTSQPVPP 1087 Score = 28.3 bits (60), Expect = 9.2 Identities = 23/98 (23%), Positives = 26/98 (26%) Frame = +2 Query: 548 PXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXXXXGPF 727 P P PP P + P V PP P PPP P Sbjct: 1026 PVPPKRKASPPSAQPLPPPRKPSPPPSAVPIPPPRKPSPPPSEPAPPPRQ--------PP 1077 Query: 728 XXXLXRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXP 841 + P P P+ P PP P P P Sbjct: 1078 PPSTSQPVPPPRQPDPIPTNPAHPTEPPPRQPKPTPAP 1115 >SB_38313| Best HMM Match : XYPPX (HMM E-Value=0.069) Length = 135 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/55 (29%), Positives = 17/55 (30%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P PP G PP P PPP P P G +S PP Sbjct: 46 PSGGYGYPPAGGYPPPQPGYAGGPPPPGIAPGIGGPPPSGQYGAPPTSQPYGAPP 100 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 31.1 bits (67), Expect = 1.3 Identities = 29/134 (21%), Positives = 34/134 (25%), Gaps = 2/134 (1%) Frame = +2 Query: 515 LNSXXXPXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPX 694 L+ P P P PP P P PF S P P PP Sbjct: 225 LHPHIPPAPPNPSKAIATPNPPMPETPLPPATPNPFIPPASPNPSIPPAPPNPSIPAPPN 284 Query: 695 SXVXXXXXGPFXXXL--XRXXPGPXPRAPLXPXXQKPXXPPXXXPXPLXXPPXXGXAXXP 868 + P+ P P + P P P P P P + P Sbjct: 285 PSIPLAPPNPYIPPAPPNLFIPSAPPNPHIPPAPPNPYI-PTAPPNPSIPPAPPNPSIPP 343 Query: 869 GFPXXXXXXPPXXP 910 P PP P Sbjct: 344 APP--NPSIPPAPP 355 >SB_35885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 476 Score = 31.1 bits (67), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKT---XXXPPPXPXPXXXPP 843 P A P PPP PP P KT PPP P PP Sbjct: 315 PAAFAPAPPPSQAPP--PPKTIPSTLPPPPVPSATSAPP 351 Score = 30.7 bits (66), Expect = 1.7 Identities = 30/125 (24%), Positives = 31/125 (24%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PPP P P S P P P PP Sbjct: 328 PPPPKTIPSTLPPPPVPSATSAPPPWATSNSGPKPLMSTPVQRPPGMRPPGAGNGPGGPP 387 Query: 721 XFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P P PPP G P A + PP P PP G F PP Sbjct: 388 PPWSKPGGILPGPPPPGPPMLNMAPS--IPPWQTTPGYIPPPPPG-----FPQFQPPPPP 440 Query: 901 PXPXA 915 P A Sbjct: 441 PPSDA 445 >SB_5325| Best HMM Match : Drf_FH1 (HMM E-Value=0.41) Length = 638 Score = 31.1 bits (67), Expect = 1.3 Identities = 19/58 (32%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXP--XPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 A P P PP P + PPP P P PP GS + S PP P Sbjct: 446 ATLPPLPSDEPPPLPPDEEKPPPPPAPALPPLPLPPELPGSPGDSPPATSPKQPPLPP 503 >SB_10571| Best HMM Match : Cas1p (HMM E-Value=1.8e-26) Length = 765 Score = 31.1 bits (67), Expect = 1.3 Identities = 16/36 (44%), Positives = 16/36 (44%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G A G Sbjct: 669 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGG 704 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 659 GGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 694 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 662 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 697 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 663 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 698 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 664 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 699 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 665 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 700 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 666 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 701 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 668 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAG 703 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 671 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAG 706 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 673 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGAGGAGAG 708 >SB_16095| Best HMM Match : Podocalyxin (HMM E-Value=1) Length = 768 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP----XXXPPXXGG 855 P A P PPP PP A PPP P P PP GG Sbjct: 656 PEAGPPPPPPP--PPGGQAGGAPPPPPPPLPGGAAPPPPPPIGG 697 Score = 30.7 bits (66), Expect = 1.7 Identities = 18/53 (33%), Positives = 20/53 (37%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P PPP PP + PPP P PP GG+ PPP P Sbjct: 660 PPPPP---PPPPGGQAGGAPPPPP-----PPLPGGAAPPPPPPIGGGAPPPPP 704 >SB_59302| Best HMM Match : Collagen (HMM E-Value=0) Length = 993 Score = 30.3 bits (65), Expect = 2.3 Identities = 17/60 (28%), Positives = 19/60 (31%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 G P P PP +PP P PP P PP G + PP P Sbjct: 878 GLPGPPGPASPP--SPPGPPGPPGPKGPPGPNGCLGPPGDAGPAGNTGGAGCQPAPPCPP 935 Score = 29.5 bits (63), Expect = 4.0 Identities = 32/115 (27%), Positives = 32/115 (27%), Gaps = 2/115 (1%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPPXSXVXXX 712 P PP P P PG G P F G P P P P Sbjct: 47 PDGPPGFPGPQGPNGPKGPPGLPGPPGPPGFQGPPGNPAGAIGPPG---LPGPNG----- 98 Query: 713 XXGPFXXXLXRXXPGPXPRAPLXPXXQKPXXPP--XXXPXPLXXPPXXGXAXXPG 871 GP PGP P P Q P PP P P P G PG Sbjct: 99 VNGPPGELGDMGPPGP----PGPPGPQMPPGPPGLPGPPGPAGPPGTNGELGPPG 149 >SB_14625| Best HMM Match : Cytadhesin_P30 (HMM E-Value=0.056) Length = 245 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP G PP PPP P P P Sbjct: 209 PPPMGGPPPMGGPPGGYPPPPPPPGAGDP 237 >SB_25368| Best HMM Match : PID (HMM E-Value=2.7e-22) Length = 1197 Score = 30.3 bits (65), Expect = 2.3 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 6/64 (9%) Frame = +1 Query: 736 PXAXXPXPP-PXGTPPXXPAKTXXXP-PPXPXPXXXPPXXGGSXXTXFS----SXSXXXP 897 P A P PP P G PP P + P PP PP S P Sbjct: 853 PSAPPPLPPRPVGAPPSLPPRPRTRPLPPKSDTPPPPPRPAADESQEMSRTRGPKDGRKP 912 Query: 898 PPXP 909 PP P Sbjct: 913 PPPP 916 >SB_19987| Best HMM Match : MFMR (HMM E-Value=1.4) Length = 330 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP TP + PPP P PP Sbjct: 283 PPPPPSNTPGMFASSGFQPPPPPPTDFAPPP 313 Score = 29.9 bits (64), Expect = 3.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 P PPP P A + PPP P PP Sbjct: 282 PPPPPPSNTPGMFASSGFQPPPPPPTDFAPP 312 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/28 (46%), Positives = 13/28 (46%), Gaps = 2/28 (7%) Frame = +1 Query: 751 PXPPPX--GTPPXXPAKTXXXPPPXPXP 828 P PPP PP P T PPP P P Sbjct: 302 PPPPPTDFAPPPPPPEPTSELPPPPPPP 329 Score = 28.3 bits (60), Expect = 9.2 Identities = 16/47 (34%), Positives = 17/47 (36%) Frame = +1 Query: 769 GTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 G PP A PPP P P P F+S PPP P Sbjct: 267 GHPPIPSASQNATPPPPPPPPSNTPG-------MFASSGFQPPPPPP 306 >SB_11627| Best HMM Match : RNA_pol_Rpb2_1 (HMM E-Value=2.6) Length = 496 Score = 30.3 bits (65), Expect = 2.3 Identities = 29/124 (23%), Positives = 33/124 (26%), Gaps = 3/124 (2%) Frame = +1 Query: 541 PPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXX 720 PP P P P P + PP P PP R Sbjct: 261 PPRYPPSPLRYPPIPPRYPPSLIRYPTLPPRY--PPSPPRYPPSPPRYPPSLHRYPQSPL 318 Query: 721 XFXGXPXAXXPXP---PPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXX 891 + P P P PP +PP P+ PP P PP S S Sbjct: 319 RYPPSPIRYPPLPSRYPP--SPPRYPSSHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRY 376 Query: 892 XPPP 903 P P Sbjct: 377 LPSP 380 Score = 29.1 bits (62), Expect = 5.2 Identities = 24/101 (23%), Positives = 27/101 (26%), Gaps = 2/101 (1%) Frame = +1 Query: 532 PXXPPPXXXXPXXXXXXPXXXFPXXXGXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXX 711 P PP P P P P + PP PS PP R Sbjct: 286 PTLPPRYPPSPPRYPPSPPRYPPSLHRYPQSPLRY--PPSPIRYPPLPSRYPPSPPRYPS 343 Query: 712 QXXXFXGXPXAXXPXPP--PXGTPPXXPAKTXXXPPPXPXP 828 + P P PP P P P+ P P P Sbjct: 344 SHPRYPPSPPRYPPSPPRYPSSHPRYPPSPLRYLPSPIRYP 384 >SB_52222| Best HMM Match : SAPS (HMM E-Value=2.1e-37) Length = 1063 Score = 29.9 bits (64), Expect = 3.0 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXPXK 723 GG G G GGG G GG GGG G G K Sbjct: 840 GGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIK 879 Score = 29.1 bits (62), Expect = 5.2 Identities = 29/109 (26%), Positives = 29/109 (26%), Gaps = 1/109 (0%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG-XXAXGXPXKXXXCXXXRXXWGGXXXGXX 666 GG G G GGG G GG GGG G G GG G Sbjct: 772 GGGDGGDGGGGGDGGGGGGGGGGGGGGGGGGDGGGYGDGDGGGGGGGGGGGGGGDGGGYG 831 Query: 665 XXGXXXXXXXXXXXXXGNPXXXGKXXXGXXXXXXGXXXXGGGXXGVXXN 519 G G G G G GGG GV N Sbjct: 832 DGGGFGDGGGYADGDGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGVIKN 880 >SB_22158| Best HMM Match : Lipoprotein_15 (HMM E-Value=8.4) Length = 184 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 3/58 (5%) Frame = +1 Query: 751 PXPPPXGT---PPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 P PPP GT PP P PPP P P + S PP A Sbjct: 122 PPPPPTGTLPPPPVTPPPGPETPPPPDTPAPPVPPTEAPPTAPPTGGSCVSKPPYKSA 179 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 29.9 bits (64), Expect = 3.0 Identities = 18/58 (31%), Positives = 19/58 (32%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P + P PP P P PPP P P PP S PPP P Sbjct: 88 PTSCAPACPPACCAPPPPPPPPPPPPPPPPP---PPITLHHEQHVVSHVMHPAPPPPP 142 Score = 29.9 bits (64), Expect = 3.0 Identities = 26/102 (25%), Positives = 29/102 (28%), Gaps = 11/102 (10%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXG--TPPXXPAK------- 795 PP P P PP P P PPP PP + Sbjct: 105 PPPPPPPPPPPPPPPPITLHHEQHVVSHVMHPAPPPPPPPPPAPCMPPCHQTQVVHSVQL 164 Query: 796 --TXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXPXA 915 + PPP P P PP S F + PPP A Sbjct: 165 HASPPGPPPAPMP-APPPMVVPSHRHVFHHVTHPAPPPMQMA 205 >SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) Length = 507 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXGXPXK 723 GG G G GGG G GG GGG G P + Sbjct: 337 GGSGRGGGGGGGGGGGGGGGGGGRGGGGGFSSRGRGPPPR 376 >SB_28396| Best HMM Match : RRM_1 (HMM E-Value=0.00035) Length = 258 Score = 29.9 bits (64), Expect = 3.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 183 GGGHGGGGYGGGGYGGGGGGYGGSGYGGGGGYGGGG 218 Score = 28.3 bits (60), Expect = 9.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGG 756 GG G G GGG + G GG GGG Sbjct: 200 GGGYGGSGYGGGGGYGGGGYGGGRSGGGG 228 >SB_57724| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 3804 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 133 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGDG 168 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXG 750 GG G G GGG G GG GGG G Sbjct: 132 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 162 >SB_47949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 280 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGG 855 PPP G PP P P P P PP GG Sbjct: 223 PPPGGMPPGR-MPPQGLPFPPPGPIPPPPGAGG 254 >SB_9057| Best HMM Match : Nucleoplasmin (HMM E-Value=3.6) Length = 479 Score = 29.5 bits (63), Expect = 4.0 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +2 Query: 752 PGPXPRAPLXPXXQKPXXPPXXXPXPLXXP 841 P P P APL P P P P PL P Sbjct: 425 PPPPPPAPLPPPPPPPPQPTTALPDPLQGP 454 >SB_58757| Best HMM Match : GRP (HMM E-Value=0.0041) Length = 154 Score = 29.5 bits (63), Expect = 4.0 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 72 GGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGGGGGG 107 Score = 28.3 bits (60), Expect = 9.2 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = -2 Query: 842 GGXXXGXGXGGGXXWVFAGXXGGVPXGGGXGXXAXG 735 GG G G GGG G GG GGG G G Sbjct: 68 GGGGGGGGGGGGGGGGDDGDGGGGDGGGGGGGGDGG 103 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 29.5 bits (63), Expect = 4.0 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGS 858 P PP TP P + PPP P P PP S Sbjct: 343 PQPPTPTTPKTHP-QLGPPPPPPPPPPTPPPDEDNS 377 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 29.5 bits (63), Expect = 4.0 Identities = 17/67 (25%), Positives = 17/67 (25%) Frame = +1 Query: 643 PPXXXPXXXXPSXXPPXXXRXXXQXXXFXGXPXAXXPXPPPXGTPPXXPAKTXXXPPPXP 822 PP P P PP P P P PP P PP P Sbjct: 441 PPHGMPQGGGPPQLPPNLPPPPGGMRGMPPPPMGMYPPPRGFPPPPFGPPPPFYRGPPPP 500 Query: 823 XPXXXPP 843 PP Sbjct: 501 RGMPPPP 507 Score = 28.3 bits (60), Expect = 9.2 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 533 PXXPPPXPXXXXXXPPXPXXXSPGXRGXPFFXGVSWXPPXXXXPXAXXXXPPP 691 P PPP P PP P P RG P PP P PPP Sbjct: 456 PNLPPP-PGGMRGMPPPPMGMYPPPRGFP-PPPFGPPPPFYRGPPPPRGMPPP 506 >SB_50258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 795 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +1 Query: 736 PXAXXPXPPPXGTP-PXXPAKTXXXPPPXPXPXXXPP 843 P P PPP G P P+K PP P PP Sbjct: 698 PLPLPPPPPPTGIDIPHSPSKDDLPLPPPPEEVSLPP 734 >SB_29252| Best HMM Match : Cytadhesin_P30 (HMM E-Value=1.4) Length = 1439 Score = 29.1 bits (62), Expect = 5.2 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = +1 Query: 763 PXGTPPXXPAKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPP 900 P T P P+ PP P P PP + F+S S P Sbjct: 332 PPVTEPAPPSSVVAPPPAVPTPATAPPPVVAPPPSVFASSSGVPTP 377 >SB_43690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 780 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 742 AXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 A P PPP PP P + PPP P P Sbjct: 752 ANVPPPPP---PPAVPGEGARPPPPPPPP 777 >SB_29559| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 858 Score = 29.1 bits (62), Expect = 5.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +1 Query: 730 GXPXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXPPXXG 852 G P A PP GT P KT PP P PP G Sbjct: 319 GGPLAPAESPPKTGTEEPSP-KTGEKRPPGLHPTDSPPRKG 358 >SB_5589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 583 Score = 29.1 bits (62), Expect = 5.2 Identities = 13/35 (37%), Positives = 13/35 (37%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXPXXXP 840 P P GTP P T PPP P P P Sbjct: 202 PSLEEPEVSAMGTPVSTPQATVQTPPPPPEPSNEP 236 >SB_20734| Best HMM Match : Abi_HHR (HMM E-Value=3.59994e-42) Length = 426 Score = 28.7 bits (61), Expect = 6.9 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPPXPXPXXXPP 843 PPP PP PA PP P PP Sbjct: 312 PPPPPLPPAMPAMDDLLPPEVLSPPPPPP 340 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 28.3 bits (60), Expect = 9.2 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 2/36 (5%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXP--PPXPXPXXXPPXXG 852 P PPP T P P P PP P PP G Sbjct: 777 PPPPPPPTKPATPRVPPNIPSRPPGARPTPPPPPPG 812 >SB_48634| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/26 (42%), Positives = 11/26 (42%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P P PP P PPP P P Sbjct: 860 PRPRPRRPPPPPPPPPPPPPPPPPPP 885 >SB_31782| Best HMM Match : FH2 (HMM E-Value=1.2e-08) Length = 1052 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 751 PXPPPXGTPPXXPAKTXXXPPPXP 822 P P P G PP P PPP P Sbjct: 198 PPPGPGGIPPPPPPIRGGVPPPPP 221 >SB_19519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 757 PPPXGTPPXXPAKTXXXPPP 816 PPP G PP P PPP Sbjct: 197 PPPSGAPPPPPIGAPPPPPP 216 >SB_2320| Best HMM Match : TFIID_20kDa (HMM E-Value=2.2) Length = 161 Score = 28.3 bits (60), Expect = 9.2 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 104 RTLRHKRRCTDHLMCNYQECQILRIPYS 21 R + + C DH+M ++EC+ L+I S Sbjct: 133 RLIEDVKSCFDHIMAKFRECKKLKISLS 160 >SB_49341| Best HMM Match : Rad21_Rec8_N (HMM E-Value=2.3) Length = 549 Score = 28.3 bits (60), Expect = 9.2 Identities = 25/103 (24%), Positives = 28/103 (27%), Gaps = 3/103 (2%) Frame = +1 Query: 610 GXPLFSRGFLXPPXXXPXXXXPSXXPPXXXRXXXQXXXFXGX--PXAXXPXPPPXGTPPX 783 G L + P P PS PP P + PP TP Sbjct: 366 GKTLIQYNPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTPSH 425 Query: 784 XP-AKTXXXPPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPPXP 909 P T PP P PP S S+ S P P Sbjct: 426 TPPVSTPSNTPPVSTPSHTPPVSTPSHTPPVSTPSHTPPVSTP 468 >SB_29257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 494 Score = 28.3 bits (60), Expect = 9.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +1 Query: 808 PPPXPXPXXXPPXXGGSXXTXFSSXSXXXPPP 903 PPP P P PP G T +S PP Sbjct: 346 PPPVPPPPSLPPRPGKQRATSVTSAHEERAPP 377 >SB_5350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 9.2 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +1 Query: 736 PXAXXPXPPPXGTPPXXPAKTXXXPPPXPXP 828 P P P P + P P PPP P P Sbjct: 358 PSTPAPTPAPLSSTPCAPFAPPPPPPPPPPP 388 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,010,629 Number of Sequences: 59808 Number of extensions: 428688 Number of successful extensions: 3099 Number of sequences better than 10.0: 63 Number of HSP's better than 10.0 without gapping: 814 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1664 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2645618622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -