BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_N02 (838 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 28 1.4 SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual 26 7.6 SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar... 26 7.6 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 28.3 bits (60), Expect = 1.4 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 204 ILQHRRPRLPLMQLEAPCSFNFCSLRA 124 I Q LP + L +PCSF CSLRA Sbjct: 48 IAQKSNISLPFLTL-SPCSFTICSLRA 73 >SPBC4F6.05c |||lectin |Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 7.6 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 206 WHW-GSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 313 W W GSVD SG N R S TS+LR+ Sbjct: 39 WKWYGSVDEDSGYVYLTSKDSNEARSGSLWSTSVLRQ 75 >SPBC1198.07c |||mannan endo-1,6-alpha-mannosidase |Schizosaccharomyces pombe|chr 2|||Manual Length = 507 Score = 25.8 bits (54), Expect = 7.6 Identities = 13/50 (26%), Positives = 21/50 (42%) Frame = +2 Query: 71 SRTLNFLNQHSSFYTCAIARREQKLKEHGASSCISGKRGRRCCNIWHWGS 220 +R L + Q + + I Q E A +C G G C +W+W + Sbjct: 372 ARFLGYTMQLAPYTVETILPYIQSSAEAAALACSGGSDGVTCGYMWYWNN 421 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,364,964 Number of Sequences: 5004 Number of extensions: 38748 Number of successful extensions: 61 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 412451140 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -