BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M24 (910 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 46 3e-05 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 46 3e-05 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 45 8e-05 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 43 3e-04 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 40 0.002 At1g20130.1 68414.m02518 family II extracellular lipase, putativ... 40 0.002 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 40 0.002 At4g30460.1 68417.m04325 glycine-rich protein 40 0.002 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 40 0.002 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 40 0.002 At1g27710.1 68414.m03387 glycine-rich protein 40 0.002 At5g46730.1 68418.m05757 glycine-rich protein 40 0.003 At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family... 39 0.004 At1g29380.1 68414.m03592 hypothetical protein 39 0.004 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 39 0.005 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 39 0.005 At1g49490.1 68414.m05547 leucine-rich repeat family protein / ex... 39 0.005 At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP1... 38 0.007 At1g61080.1 68414.m06877 proline-rich family protein 38 0.007 At1g26150.1 68414.m03192 protein kinase family protein similar t... 38 0.009 At1g02405.1 68414.m00187 proline-rich family protein contains pr... 38 0.009 At5g38560.1 68418.m04662 protein kinase family protein contains ... 38 0.012 At5g08230.1 68418.m00965 PWWP domain-containing protein putative... 38 0.012 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 38 0.012 At3g11030.1 68416.m01331 expressed protein contains Pfam domain ... 38 0.012 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 38 0.012 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 37 0.016 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 37 0.016 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 37 0.016 At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 37 0.016 At3g24480.1 68416.m03070 leucine-rich repeat family protein / ex... 37 0.021 At4g27850.1 68417.m03999 proline-rich family protein contains pr... 36 0.028 At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 36 0.037 At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family... 36 0.037 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 36 0.037 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 36 0.049 At2g27390.1 68415.m03306 proline-rich family protein contains pr... 36 0.049 At2g30560.1 68415.m03722 glycine-rich protein 35 0.065 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 35 0.065 At1g10620.1 68414.m01204 protein kinase family protein contains ... 35 0.065 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 35 0.086 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 35 0.086 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 35 0.086 At4g15200.1 68417.m02329 formin homology 2 domain-containing pro... 35 0.086 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 35 0.086 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 35 0.086 At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F... 35 0.086 At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F... 35 0.086 At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid t... 34 0.11 At4g01985.1 68417.m00265 expressed protein 34 0.11 At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid t... 34 0.11 At2g28490.1 68415.m03462 cupin family protein similar to preproM... 34 0.11 At2g25050.1 68415.m02996 formin homology 2 domain-containing pro... 34 0.11 At1g17790.1 68414.m02202 DNA-binding bromodomain-containing prot... 34 0.11 At1g02710.1 68414.m00222 glycine-rich protein 34 0.11 At5g25550.1 68418.m03040 leucine-rich repeat family protein / ex... 34 0.15 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 34 0.15 At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identica... 34 0.15 At5g04970.1 68418.m00526 pectinesterase, putative contains simil... 34 0.15 At1g70460.1 68414.m08107 protein kinase, putative contains Pfam ... 34 0.15 At5g59170.1 68418.m07416 proline-rich family protein contains pr... 33 0.20 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 33 0.20 At4g16980.1 68417.m02560 arabinogalactan-protein family similar ... 33 0.20 At3g24550.1 68416.m03083 protein kinase family protein contains ... 33 0.20 At1g75550.1 68414.m08780 glycine-rich protein 33 0.20 At4g18570.1 68417.m02749 proline-rich family protein common fami... 33 0.26 At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid t... 33 0.26 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 33 0.26 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 33 0.26 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 33 0.26 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 33 0.35 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 33 0.35 At5g14920.1 68418.m01750 gibberellin-regulated family protein si... 33 0.35 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 33 0.35 At4g39680.1 68417.m05614 SAP domain-containing protein contains ... 33 0.35 At4g33660.1 68417.m04781 expressed protein 33 0.35 At4g08370.1 68417.m01382 proline-rich extensin-like family prote... 33 0.35 At1g15840.1 68414.m01901 expressed protein 33 0.35 At5g56330.1 68418.m07031 carbonic anhydrase family protein conta... 32 0.46 At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid t... 32 0.46 At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacy... 32 0.46 At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) 32 0.60 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 32 0.60 At3g24540.1 68416.m03082 protein kinase family protein contains ... 32 0.60 At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar... 32 0.60 At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibit... 32 0.60 At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) ... 32 0.60 At1g27750.1 68414.m03391 ubiquitin system component Cue domain-c... 32 0.60 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 32 0.60 At1g12040.1 68414.m01390 leucine-rich repeat family protein / ex... 32 0.60 At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear... 31 0.80 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 0.80 At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin fa... 31 0.80 At3g50580.1 68416.m05532 proline-rich family protein contains pr... 31 0.80 At3g43583.1 68416.m04636 hypothetical protein 31 0.80 At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein ... 31 0.80 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 31 0.80 At2g27380.1 68415.m03302 proline-rich family protein contains pr... 31 0.80 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 31 0.80 At2g05440.1 68415.m00574 glycine-rich protein 31 0.80 At1g49270.1 68414.m05524 protein kinase family protein contains ... 31 0.80 At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi do... 31 0.80 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 31 0.80 At1g23540.1 68414.m02960 protein kinase family protein contains ... 31 0.80 At1g15830.1 68414.m01900 expressed protein 31 0.80 At1g04800.1 68414.m00476 glycine-rich protein 31 0.80 At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identic... 31 1.1 At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family... 31 1.1 At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family... 31 1.1 At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family... 31 1.3 At5g67470.1 68418.m08507 formin homology 2 domain-containing pro... 31 1.4 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 31 1.4 At5g14540.1 68418.m01704 proline-rich family protein contains pr... 31 1.4 At2g43150.1 68415.m05358 proline-rich extensin-like family prote... 31 1.4 At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PL... 31 1.4 At2g05440.2 68415.m00575 glycine-rich protein 31 1.4 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 31 1.4 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 31 1.4 At1g63550.1 68414.m07184 hypothetical protein low similarity to ... 31 1.4 At5g58540.1 68418.m07330 protein kinase family protein contains ... 30 1.8 At5g53870.1 68418.m06701 plastocyanin-like domain-containing pro... 30 1.8 At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family... 30 1.8 At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family... 30 1.8 At4g34440.1 68417.m04894 protein kinase family protein contains ... 30 1.8 At4g29030.1 68417.m04151 glycine-rich protein glycine-rich prote... 30 1.8 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 30 1.8 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 30 1.8 At3g07540.1 68416.m00900 formin homology 2 domain-containing pro... 30 1.8 At3g05920.1 68416.m00668 heavy-metal-associated domain-containin... 30 1.8 At3g05470.1 68416.m00599 formin homology 2 domain-containing pro... 30 1.8 At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein si... 30 2.4 At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identic... 30 2.4 At3g51290.1 68416.m05614 proline-rich family protein 30 2.4 At3g50180.1 68416.m05486 hypothetical protein 30 2.4 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 30 2.4 At3g07100.1 68416.m00845 protein transport protein Sec24, putati... 30 2.4 At1g76040.2 68414.m08829 calcium-dependent protein kinase, putat... 30 2.4 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 30 2.4 At5g61660.1 68418.m07736 glycine-rich protein 29 3.2 At5g04290.1 68418.m00422 KOW domain-containing transcription fac... 29 3.2 At4g23882.1 68417.m03434 heavy-metal-associated domain-containin... 29 3.2 At3g25500.1 68416.m03171 formin homology 2 domain-containing pro... 29 3.2 At2g28440.1 68415.m03455 proline-rich family protein contains pr... 29 3.2 At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identic... 29 3.2 At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identic... 29 3.2 At2g05530.1 68415.m00585 glycine-rich protein 29 3.2 At1g70990.1 68414.m08190 proline-rich family protein 29 3.2 At1g63570.1 68414.m07186 receptor-like protein kinase-related co... 29 3.2 At1g62240.1 68414.m07021 expressed protein 29 3.2 At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to S... 29 3.2 At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to S... 29 3.2 At5g62210.1 68418.m07811 embryo-specific protein-related contain... 29 4.3 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 29 4.3 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 29 4.3 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 29 4.3 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 29 4.3 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 29 4.3 At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical t... 29 4.3 At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical t... 29 4.3 At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kin... 29 4.3 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 29 4.3 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 29 5.6 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 29 5.6 At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family... 29 5.6 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 29 5.6 At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family... 29 5.6 At3g62680.1 68416.m07041 proline-rich family protein contains pr... 29 5.6 At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein ... 29 5.6 At3g55950.1 68416.m06217 protein kinase family protein contains ... 29 5.6 At3g53330.1 68416.m05884 plastocyanin-like domain-containing pro... 29 5.6 At3g32400.1 68416.m04142 formin homology 2 domain-containing pro... 29 5.6 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 5.6 At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family... 29 5.6 At1g67770.1 68414.m07733 RNA-binding protein, putative similar t... 29 5.6 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 5.6 At5g43770.1 68418.m05353 proline-rich family protein contains pr... 28 7.4 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 28 7.4 At4g08380.1 68417.m01384 proline-rich extensin-like family prote... 28 7.4 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 28 7.4 At2g38910.1 68415.m04783 calcium-dependent protein kinase, putat... 28 7.4 At2g34670.1 68415.m04259 proline-rich family protein contains pr... 28 7.4 At2g05510.1 68415.m00583 glycine-rich protein 28 7.4 At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical ... 28 7.4 At1g62250.2 68414.m07023 expressed protein 28 7.4 At1g62250.1 68414.m07022 expressed protein 28 7.4 At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative ... 28 7.4 At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein ... 28 7.4 At5g25590.1 68418.m03045 expressed protein contains Pfam profile... 28 9.8 At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family... 28 9.8 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 28 9.8 At5g19080.1 68418.m02268 zinc finger (C3HC4-type RING finger) fa... 28 9.8 At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; g... 28 9.8 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 28 9.8 At3g28820.1 68416.m03596 expressed protein ; expression support... 28 9.8 At3g28810.1 68416.m03595 hypothetical protein 28 9.8 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 28 9.8 At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) fa... 28 9.8 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 28 9.8 At1g70250.1 68414.m08082 receptor serine/threonine kinase, putat... 28 9.8 At1g63600.1 68414.m07189 protein kinase-related low similarity t... 28 9.8 At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family... 28 9.8 At1g07135.1 68414.m00759 glycine-rich protein 28 9.8 At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family... 28 9.8 At1g04660.1 68414.m00463 glycine-rich protein 28 9.8 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 46.4 bits (105), Expect = 3e-05 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 4/52 (7%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAP----XSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P P+ SP P P S P PPPP P PPP P P Sbjct: 422 TLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPP 473 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 6/47 (12%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAP------XSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ SP P S P S P PPPP P PPP P Sbjct: 470 PPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPP 516 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/49 (44%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP--XSPPPPXXPXXXXPP---PSPXSP 877 P PP P P+ SP P P P SPPPP P PP P P SP Sbjct: 439 PPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSP 487 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/43 (46%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP--XSPPPPXXPXXXXPPPSP 868 P PP P P+ SP P P P SPPPP PPPSP Sbjct: 485 PSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPPSP 527 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/44 (45%), Positives = 21/44 (47%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P P PPPP P PPPSP P Sbjct: 454 PPPPPPPPPVYSPPP-------PPPPPPPPPPVYSPPPPSPPPP 490 Score = 42.3 bits (95), Expect = 4e-04 Identities = 19/42 (45%), Positives = 20/42 (47%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P +P P SPPPP P PPP P P Sbjct: 466 PPPPPPPPPPPPPVYSPP--PPSPPPPPPPVYSPPPPPPPPP 505 Score = 39.1 bits (87), Expect = 0.004 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P S P PPP P PPP P Sbjct: 466 PPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPP 506 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P PP P P+ SP P S P P P P PPP P SP Sbjct: 500 PPPPPPPPPVYSPPPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSP 545 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPX--PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P S+P P PPP P PPP P Sbjct: 581 PPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPP 623 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP-PSPXS 874 P P SP P S P P SPPPP P PP P+P S Sbjct: 564 PPPHSSPPPHSPPP--PHSPPPPIYPYLSPPPPPTPVS 599 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P L SP P S P PPPP P PP P P Sbjct: 410 PPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPP 457 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/44 (40%), Positives = 18/44 (40%), Gaps = 5/44 (11%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP-----PPXXPXXXXPPPSP 868 PP P P SP P P P PP PP P PPP P Sbjct: 571 PPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSPPPPPP 614 Score = 35.1 bits (77), Expect = 0.065 Identities = 18/48 (37%), Positives = 18/48 (37%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P P P P PPP P PPP P SP Sbjct: 535 TRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPP-PHSP 581 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSPXSP 877 P P L SP P + S P SPPPP P PP P P Sbjct: 401 PLPPPSLPSPPPPAPIFSTPPTLTSPPPPSPPPPVYSPPPPPPP 444 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP--XSPPPPXXPXXXXPPPSPXSPH 880 P PP P P P +P P PPPP PPP P H Sbjct: 591 PPPPPTPVSSPPPTPVYSPPPPPPCIEPPPPPPCIEYSPPPPPPVVH 637 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP SP P S P PPPP P PPP+P H Sbjct: 672 PPPPEVHYHSPPPSPVHYSSP--PPPPSAPCEESPPPAPVVHH 712 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +2 Query: 746 PXPPX--QPXPLXSPXPXSAPXSXPXSPPP--PXXPXXXXPPPSP 868 P PP P P SP P + P PPP P P PPP P Sbjct: 513 PPPPVYSSPPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEP 557 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXS--XP-XSPPPPXXPXXXXPPPSPXSP 877 P PP P SP P +P P SPPPP P PP SP Sbjct: 563 PPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPPPTPVSSPPPTPVYSP 609 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ S P + P SPPPP PPP P Sbjct: 408 PSPPP-PAPIFSTPP-TLTSPPPPSPPPPVYSPPPPPPPPP 446 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/42 (42%), Positives = 20/42 (47%), Gaps = 5/42 (11%) Frame = +2 Query: 752 PPXQPXPLXS-PXPXSAP----XSXPXSPPPPXXPXXXXPPP 862 PP +P S P P S+P P SPPPP P PPP Sbjct: 553 PPPEPYYYSSPPPPHSSPPPHSPPPPHSPPPPIYPYLSPPPP 594 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/45 (37%), Positives = 19/45 (42%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP P P S+P SPPP P PPP P P+ Sbjct: 545 PPPPQFSPPPPEPYYYSSPPPPHSSPPPHSPPPPHSPPP-PIYPY 588 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPL----XSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P+ P P +P SPPPP PPP SP Sbjct: 523 PPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSP 570 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQPXPLX------SPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSPH 880 P PP P P P P +P SPPPP PPP S PH Sbjct: 521 PPPPPSPAPTPVYCTRPPPPPPHSPPPPQFSPPPPEPYYYSSPPPPHSSPPPH 573 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP P SP P P S P PP P PP P H Sbjct: 682 PPPSPVHYSSPPP---PPSAPCEESPPPAPVVHHSPPPPMVHH 721 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP SP P P SPPPP PPP P Sbjct: 629 PPPPPPVVHYSSPPP---PPVYYSSPPPPPVYYSSPPPPPP 666 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P SP P S P PPPP PPP Sbjct: 641 PPPPPVYYSSPPPPPVYYSSP--PPPPPVHYSSPPPP 675 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P SP P P SPPPP PPPSP Sbjct: 651 PPPPPVYYSSPPPP--PPVHYSSPPPPEV-HYHSPPPSP 686 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P PPPP PPP P Sbjct: 609 PPPPPPCIEP-PPPPPCIEYSPPPPPPVVHYSSPPPPP 645 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P S PPP PPP P Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPPP 655 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/37 (35%), Positives = 14/37 (37%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P + P P SPPPP PPP Sbjct: 618 PPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 46.4 bits (105), Expect = 3e-05 Identities = 24/55 (43%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXX-PPPSPXSPHXXXXXSLLP 907 P PP P P SP P P S P SPPPP P PPP+P P LP Sbjct: 66 PPPPCPPPP--SPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQPSPPTPDLP 118 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/38 (44%), Positives = 17/38 (44%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P SP P P P PPPP P PPP P P Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPP 83 Score = 41.5 bits (93), Expect = 7e-04 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P +P P P P P P P PP P PPPSP P L P Sbjct: 50 PSPEPEPEPADCPPPPPPPPCPPP-PSPPPCPPPPSPPPSPPPPQLPPPPQLPP 102 Score = 39.9 bits (89), Expect = 0.002 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P P PPPP P PP P SP Sbjct: 46 PPPSPSPEPEPEPADCPPPPPPPPCPPPPSPPPCPPPPSPPPSP 89 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P P SPPP P PPP P Sbjct: 62 PPPPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPP 103 Score = 35.9 bits (79), Expect = 0.037 Identities = 19/52 (36%), Positives = 19/52 (36%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 PP P P P P P P PPP P P P P SP LP Sbjct: 46 PPPSPSPEPEPEPADCPPPPP--PPPCPPPPSPPPCPPPPSPPPSPPPPQLP 95 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 44.8 bits (101), Expect = 8e-05 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P P P P PPPP PPP P SP Sbjct: 377 PSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSP 420 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P P PPPP PPP P P Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPP 421 Score = 40.7 bits (91), Expect = 0.001 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSP 868 P PP P P P P P S P PPP P PPPSP Sbjct: 399 PPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPPSP 440 Score = 40.3 bits (90), Expect = 0.002 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P P P PPPP P PP P Sbjct: 389 PPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPP 429 Score = 37.5 bits (83), Expect = 0.012 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P P PPP P PPP P Sbjct: 391 PPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPP 431 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP-----XSPPPPXXPXXXXPPPSP 868 P PP P P P P P P PPPP P PPP P Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 35.5 bits (78), Expect = 0.049 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +2 Query: 779 SPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 SP P P PPPP P PPP P P+ Sbjct: 375 SPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPY 408 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXS--PPPPXXPXXXXPPPSPXSPH 880 P P P SP P P P PPPP P PPP P+ Sbjct: 411 PSPPPPPPSPPPYVYPPPPPPYVYPPPPSPPYVYPPPPPSPQPY 454 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P P P P PP PPPSP Sbjct: 414 PPPPPSPPPYVYPPPPP-PYVYPPPPSPPY--VYPPPPPSP 451 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P S P P PPP P PP P Sbjct: 426 PPPPPPYVYPPPPSPPYVYPP-PPPSPQPYMYPSPPCNDLP 465 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P+ SP P S P SPPPP P PP P SP Sbjct: 735 PPPPPTPIHSPPPQSHPPCIEYSPPPP--PTVHYNPPPPPSP 774 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/45 (44%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXP-LXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P + P P S P S P SPP P P P PSP +P Sbjct: 521 PSPSISPSPPITVPSPPSTPTS-PGSPPSPSSPTPSSPIPSPPTP 564 Score = 36.7 bits (81), Expect = 0.021 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXS-PPPPXXPXXXXPPPSPXSP 877 P P P P SP S S P + P PP P PPSP SP Sbjct: 508 PSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSPPSPSSP 552 Score = 36.7 bits (81), Expect = 0.021 Identities = 20/51 (39%), Positives = 21/51 (41%), Gaps = 3/51 (5%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP---PSPXSP 877 T P P Q P P P S P SP PP P PP P+P SP Sbjct: 566 TPPTPISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPPIVGPTPSSP 616 Score = 35.9 bits (79), Expect = 0.037 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXS-PPPPXXPXXXXPPPSP 868 P PP P P SP S S P + P PP P PPSP Sbjct: 411 PSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSPGGSPPSP 452 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQ-PXPLXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSPXSP 877 P PP P P +P P +P S P PP P PP SP +P Sbjct: 430 PSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTP 475 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P P P S P SPPPP PPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPP 804 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P SP S S P + P P P P+P Sbjct: 437 PSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSPPTSPTTPTP 477 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXS--XPXSPPPPXXPXXXXPPPSPXSP 877 P P P SP P S S P +PP P P PP P P Sbjct: 540 PTSPGSPPSPSSPTPSSPIPSPPTPSTPPTPISPGQNSPPIIPSPP 585 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P +P P +P S P +P P P P+P Sbjct: 463 PSPGSPPTSPTTPTPGGSPPSSPTTPTPGGSPPSSPTTPTP 503 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXP-LXSPXPXSAPXSXPXSP----PPPXXPXXXXPPPSPXSP 877 PP P P P P S+P S P P PP P PPPS +P Sbjct: 578 PPIIPSPPFTGPSPPSSP-SPPLPPVIPSPPIVGPTPSSPPPSTPTP 623 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P +P P +P S SP PP PSP Sbjct: 407 PVVVPSPPTTPSPGGSPPSPSISPSPPITVPSPPTTPSP 445 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXP-LXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P + P P + P P P P PSP SP Sbjct: 424 PSPSISPSPPITVPSPPTTPSPGGSPPSPSIVPSPPSTTPSPGSP 468 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P P P P P SPPPP P PP S Sbjct: 713 PQPPPPPHYSLPPPTPTYHYISPPPPPTPIHSPPPQS 749 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPP----PXXPXXXXPPPSPXSP 877 PP P +P P +P S P +P P P P P SP SP Sbjct: 481 PPSSPT---TPTPGGSPPSSPTTPTPGGSPPSSPTTPSPGGSPPSP 523 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/51 (35%), Positives = 18/51 (35%), Gaps = 6/51 (11%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP------PPXXPXXXXPPPSPXSPH 880 P PP P P A S P SPP PP P PP P H Sbjct: 758 PPPPPTVHYNPPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIH 808 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 17/39 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P +P P +P S P +P P P PSP Sbjct: 494 PPSSPT---TPTPGGSPPSSPTTPSPGGSPPSPSISPSP 529 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPX--SXPXS-PPPPXXPXXXXPPPSPXSP 877 P P P P+ SP S P S P + P PP P PP P P Sbjct: 562 PTPSTPPTPI-SPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIPSPP 607 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQPXPLXS-------PXPXSAPXSXPXSPPPP-XXPXXXXPPPSPXSP 877 P P P P S P P +P S SP PP P P SP SP Sbjct: 495 PSSPTTPTPGGSPPSSPTTPSPGGSPPSPSISPSPPITVPSPPSTPTSPGSP 546 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 3/57 (5%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P+ SP S P + P SP PP P PSP S ++P Sbjct: 549 PSSPTPSSPIPSPPTPSTPPT-PISPGQNSPPIIPSPPFTGPSPPSSPSPPLPPVIP 604 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP-XSPPPPXXP 841 P PP P P P S P P S PPP P Sbjct: 589 PSPPSSPSPPLPPVIPSPPIVGPTPSSPPPSTP 621 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P+ P + SPPPP PPP P Sbjct: 779 PPPSP-PVYYYNSPPPPPAVHYSPPPPPVIHHSQPPPPP 816 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 40.3 bits (90), Expect = 0.002 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP----PPXXPXXXXPPPSPXSP 877 P PP P P P P P S P PP PP P PPP P SP Sbjct: 1071 PLPPLPPSP-PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSP 1117 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/54 (38%), Positives = 21/54 (38%), Gaps = 2/54 (3%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP--XXPXXXXPPPSPXSPHXXXXXSL 901 P PP P P S P P PPPP P PPPSP P SL Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPPPSQSL 1132 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSP 868 T P P P PL P P P PPP P P PPP P Sbjct: 1052 TEFNPLPEDSP-PLPQESPPPLPPLPPSPPPPSPPLPPSSLPPPPP 1096 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXP--PPSPXSP 877 P P P PL P P S P P PP PP P P PP P P Sbjct: 1063 PLPQESPPPLP-PLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQP 1110 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +2 Query: 779 SPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 +P P +P SPPP PPPSP P Sbjct: 1055 NPLPEDSPPLPQESPPPLPPLPPSPPPPSPPLP 1087 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 1/39 (2%) Frame = +2 Query: 764 PXPLXSPX-PXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P SP P +P P PP P P PP S P Sbjct: 1056 PLPEDSPPLPQESPPPLPPLPPSPPPPSPPLPPSSLPPP 1094 >At1g20130.1 68414.m02518 family II extracellular lipase, putative contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase; similar to EXL3 (PMID:11431566) Length = 1006 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 746 PXPPX-QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP QP P P P AP P P P P P P P PH Sbjct: 70 PTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPH 115 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX-SPPPPXXPXXXXPPPSPXSP 877 P P P P P P AP P SPPP P PP P +P Sbjct: 28 PSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTP 72 Score = 37.1 bits (82), Expect = 0.016 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ P P P P PP P P P+P Sbjct: 87 PAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTP 127 Score = 36.3 bits (80), Expect = 0.028 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSP 868 P PP +P P P P P P PP P PPP P Sbjct: 79 PAPPPEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKP 121 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P+ P P S P + P P P P P P P Sbjct: 4 PTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPP 44 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXS---PPPPXXPXXXXPPPSPXSP 877 P P +P P SP P +P P PPP P P P P P Sbjct: 36 PKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPP 82 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP-PPXXPXXXXPPPSP 868 P P P P P P P P PP PP PPP P Sbjct: 44 PAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 35.1 bits (77), Expect = 0.065 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P +P P P P P P P+P Sbjct: 83 PEPKPAPPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAP 123 Score = 34.7 bits (76), Expect = 0.086 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXP-PPSP 868 P P QP P +P P P P P P P P PP P Sbjct: 34 PPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKP 75 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPPPSP 868 P P +P P SP AP P P PPP P PSP Sbjct: 89 PPPAPKPVPCPSPPKPPAPTPKPVPPHGPPPKPAPAPTPAPSP 131 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P P P + P + P P P P P P P Sbjct: 52 PSPPPKPQPKPVP-PPACPPTPPKPQPKPAPPPEPKPAPPP 91 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP-XSPPPPXXPXXXXPPPSPXSP 877 PP P P P AP P +PPP P PP P +P Sbjct: 65 PPACPPTPPKPQPKPAPPPEPKPAPPPAPKPVPCPSPPKPPAP 107 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P P P P +P P P P PSP P Sbjct: 99 PSPPKPPAPTPKPVPPHGPPPKP-APAPTPAPSPK-PAPSPPKP 140 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P SP P P P P P P P P P Sbjct: 22 PVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPPKPQPKPVPP 65 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P SP P P P PP P P P P Sbjct: 42 PPPAPSPSPCPSPPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP 85 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P QP P+ P P P PP P PPP+P Sbjct: 54 PPPKPQPKPVPPPACPPTPPKPQPKPAPPPEP-KPAPPPAP 93 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P P + P +PP P P P P P Sbjct: 48 PSPCPSPPPKPQPKPV-PPPACPPTPPKPQPKPAPPPEPKPAPP 90 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P S P +PP P P P P P Sbjct: 3 PPTPDPSPKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPP 43 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P P PP P P PSP Sbjct: 10 PKPVAPPGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSP 50 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P +P P P +P P PPP P P P Sbjct: 16 PGPSSKPVAPPGPSPCPSPPPKPQPKPPPAPSPSPCPSPPP 56 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 39.9 bits (89), Expect = 0.002 Identities = 21/46 (45%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 PP P P+ SP P S P SPPPP P PPP SP P Sbjct: 533 PPPPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPP 578 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPX--QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P PP P P+ SP P P PPP P PPP SP P Sbjct: 568 PPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP 615 Score = 34.7 bits (76), Expect = 0.086 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P + S P SPPPP P PPP SP Sbjct: 582 PPPPVHSPPPPVHSPPPPAPVHSPPPPVHSPPPP--PPVYSPPPPVFSP 628 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS-APXSXPXSPPPPXX----PXXXXPPPSP 868 PP P P+ SP P +P SPPPP P PPP+P Sbjct: 558 PPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPPPAP 601 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P +P SPPPP PPP SP Sbjct: 526 PPPPVYSPP-PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSP 568 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P P ++P SPPPP P PPP SP P Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPP 553 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQ-PXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPPPSP 868 P P P P+ SP P P P P PP P PPP P Sbjct: 520 PAPVNSPPPPVYSPPPPPPPVHSPPPPVHSPPPPPVYSPPPPPP 563 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 3/42 (7%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPSPXSPH 880 P P+ SP P P P P PPP P PPP P H Sbjct: 527 PPPVYSPPPPPPPVHSPPPPVHSPPP--PPVYSPPPPPPPVH 566 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 10/54 (18%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPXSAPXSXP----XSPPPP---XXPXXXXPPPSPXSP 877 P PP P P+ SP P P P SPPPP P PPP SP Sbjct: 543 PPPPVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSP 596 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ SP P S P P PPP P PPP P Sbjct: 575 PPPPVYSPPPPVHSPPPPVHSPPPPAPVHSPPP--PVHSPPPPPP 617 Score = 31.5 bits (68), Expect = 0.80 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPP---PXXPXXXXPPP--SPXSP 877 P PP P P+ SP P S P PPP P P PPP SP P Sbjct: 536 PPPPVHSPPPPVHSPPPPPV-YSPPPPPPPVHSPPPPVFSPPPPVYSPPPP 585 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +2 Query: 746 PXPPXQ-PXPLXSPXPXSAP---XSXPXSPPPPXXPXXXXPPPSP 868 P P P P+ SP P +P S P PP P PPP+P Sbjct: 615 PPPVYSPPPPVFSPPPSQSPPVVYSPPPRPPKINSPPVQSPPPAP 659 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPP--PXXPXXXXPPPSPXSP 877 P P P+ SP P P P PPP P PPPS P Sbjct: 596 PPPPAPVHSPPP---PVHSPPPPPPVYSPPPPVFSPPPSQSPP 635 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/42 (42%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXX---PXXXXPPPSP 868 PP P P+ SP P P P PPPP P PPP P Sbjct: 518 PP--PAPVNSPPP---PVYSPPPPPPPVHSPPPPVHSPPPPP 554 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXX-PPPSP 868 P PP P P P +P SPPP P PPP P Sbjct: 605 PPPPVHSPP--PPPPVYSPPPPVFSPPPSQSPPVVYSPPPRP 644 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P +P PPP P PP P Sbjct: 614 PPPPVYSPPPPVFSPPPSQSPPVV--YSPPPRPPKINSPPVQSPPP 657 >At4g30460.1 68417.m04325 glycine-rich protein Length = 162 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/41 (43%), Positives = 20/41 (48%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G+ G G G G+ GG G Sbjct: 118 GSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYGGGYG 158 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G GGGG G G G G G G GG G Sbjct: 114 GRGRGSGGGGGHGGGGGGGGGRGGGGGSGNGEGYGEGGGYG 154 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G G GGG G GGGG G G G G G G+ GG Sbjct: 121 GGGGHGGGGGGGGGRGGGG--GSGNGEGYGEGGGYGGGYGGG 160 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP Q P P S P P PPPP PPP P PH Sbjct: 12 PQPPSQNSLAPPPPPPSLPPPVP--PPPPSHQPYSYPPPPPPPPH 54 Score = 37.1 bits (82), Expect = 0.016 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ P P P S P PPPP P P Sbjct: 24 PPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYP 64 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P P S P A P PPPP P PSP +P Sbjct: 571 TPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAP 618 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P P QP P P P P S P P P PPPS Sbjct: 588 PPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPS 627 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P S +PPPP PPP P Sbjct: 703 PLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPP 743 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 8/53 (15%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPP--------XXPXXXXPPPSP 868 T P PP P PL + +P P PPPP P PPP P Sbjct: 479 TLLPPPPPPPPPPLFTSTTSFSPSQPPPPPPPPPLFMSTTSFSPSQPPPPPPP 531 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/43 (41%), Positives = 18/43 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P PP P PL P S P PPPP PPP P S Sbjct: 696 PKPPAPP-PLP---PSSTRLGAPPPPPPPPLSKTPAPPPPPLS 734 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P S P S P PPPP P P +P Sbjct: 658 PPPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAP 701 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXX----PPPSPXSP 877 PP P P P P + + P P PP P PPP P P Sbjct: 676 PPSTPPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPP 721 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/52 (36%), Positives = 19/52 (36%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP--------XXPXXXXPPPSPXSP 877 P PP P P P AP P PPPP P PPP P P Sbjct: 640 PPPPPPPPPTRIPAAKCAP---PPPPPPPTSHSGSIRVGPPSTPPPPPPPPP 688 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP 832 P PP P PL +P P PPPP Sbjct: 504 PPPPPPPPPLFMSTTSFSPSQPPPPPPPP 532 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 10/51 (19%) Frame = +2 Query: 746 PXPPXQPXP----LXSPXPXSAPXSXPXS------PPPPXXPXXXXPPPSP 868 P PP P P +P P + P P S PPPP P P P P Sbjct: 680 PPPPPPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPP 730 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/49 (32%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXS-----PPPPXXPXXXXPPPSPXSP 877 P PP + +P P + P P S PPPP P P P P Sbjct: 684 PPPPPKANISNAPKPPAPPPLPPSSTRLGAPPPPPPPPLSKTPAPPPPP 732 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/65 (29%), Positives = 22/65 (33%), Gaps = 11/65 (16%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP-----------XXPXXXXPPPSPXSPHXXXX 892 P PP P PL + +P P PP P P PPP P P Sbjct: 525 PPPPPPPPPLFTSTTSFSPSQPPPPPPLPSFSNRDPLTTLHQPINKTPPPPPPPPPPLPS 584 Query: 893 XSLLP 907 S+ P Sbjct: 585 RSIPP 589 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP------XXPXXXXPPPSPXSP 877 P PP P P P +P + P PPPP PPP P P Sbjct: 599 PPPPPPPPPSSRSIP--SPSAPPPPPPPPPSFGSTGNKRQAQPPPPPPPP 646 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/41 (36%), Positives = 15/41 (36%), Gaps = 2/41 (4%) Frame = +2 Query: 761 QPXPLXSPXPXSAPXSXPXS--PPPPXXPXXXXPPPSPXSP 877 QP P P P P PPP P PPP P P Sbjct: 566 QPINKTPPPPPPPPPPLPSRSIPPPLAQPPPPRPPPPPPPP 606 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/46 (32%), Positives = 16/46 (34%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P S + P P PPP P PP P P Sbjct: 619 PPPPPPPPSFGSTGNKRQAQPPPPPPPPPPTRIPAAKCAPPPPPPP 664 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSX-PXSPPPPXXPXXXXPPPSP 868 P PP P +P P P S P PPPP P P Sbjct: 714 PPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPP 755 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 6/49 (12%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP------XXPXXXXPPPSPXS 874 P PP P P + P PPPP P PPP P S Sbjct: 659 PPPPPPPTSHSGSIRVGPPSTPPPPPPPPPKANISNAPKPPAPPPLPPS 707 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/53 (32%), Positives = 18/53 (33%), Gaps = 2/53 (3%) Frame = +2 Query: 755 PXQPXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P QP P P P S P PPPP P + SP LP Sbjct: 501 PSQPPPPPPPPPLFMSTTSFSPSQPPPPPPPPPLFTSTTSFSPSQPPPPPPLP 553 >At1g27710.1 68414.m03387 glycine-rich protein Length = 212 Score = 39.9 bits (89), Expect = 0.002 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGG G G G G G GW GG G Sbjct: 110 GGPGYGGGGYGPGGGGGGVVIGGGFGGGAGYGSGGGLGWDGGNG 153 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G G G G G G Sbjct: 141 GSGGGLGWDGGNGGGGPGYGSGGGGIGGGGGIGGGVIIGGG 181 >At5g46730.1 68418.m05757 glycine-rich protein Length = 290 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/44 (43%), Positives = 19/44 (43%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GG G G E G G G G G GG G Sbjct: 170 GHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHGGAGGYGGGG 213 Score = 36.7 bits (81), Expect = 0.021 Identities = 18/41 (43%), Positives = 19/41 (46%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G+ G G G G GG G Sbjct: 212 GGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYG 252 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G GGGG G G G G G G+ G G Sbjct: 195 GGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGG 238 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGG G G+ G GE G G G G Sbjct: 161 GGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEGGGAGGGGSHG 204 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/42 (45%), Positives = 19/42 (45%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G G GGG G GGGG G E G G G G G GG Sbjct: 249 GGYGGGGG----GGEGGGGSYGGEHGGGSGGGHGGGGGHGGG 286 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GEGGG G GG G G G G G G G G G Sbjct: 192 GEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGG 232 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGE G G G GE G G+ G G Sbjct: 37 GGHGGGGGSGGVSSGGYGGESGGGYGG--GSGEGAGGGYGGAEG 78 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/45 (40%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = -2 Query: 867 GEGGGX----XXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GEGGG G GGGG G G G G G+ GG G Sbjct: 150 GEGGGAGASGYGGGAYGGGGGHGGGGGGGSAGGAHGGSGYGGGEG 194 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGG G G G G G G GG G Sbjct: 156 GASGYGGGAYGGGGGHGGGGGGGSAGGAHG-GSGYGGGEGGGAG 198 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G GGG G G G G G G GG G Sbjct: 215 GGSGGGGAYGGGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGG 258 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG G GGGE G G G G G GG G Sbjct: 225 GGGAHGGGYGSGGGEGGGYGGGAAGGYGGGGGGGEGGGG 263 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G G GG G G G G G GG G Sbjct: 201 GSHGGAGGYGGGGGGGSGGGGAYGGGGAHGGGYGSGGGEGGGYG 244 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G GGGG G G G G G G G G Sbjct: 186 GSGYGGGEGGGAGGGGSHGGAGGYGGGGGGGSGGGGAYGGG 226 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -2 Query: 858 GGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GG G G GE G + G G G G GG G Sbjct: 138 GGEHASGYGNGAGEGGGAGASGYGGGAYGGGGGHGGGG 175 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEX--GXEXGAXXGXGEXRGXGWXGGXG 745 G GGG GGGG G G G G G G GG G Sbjct: 242 GYGGGAAGGYGGGGGGGEGGGGSYGGEHGGGSGGGHGGGGGHG 284 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -2 Query: 876 GEXGEGGGXXXXGXX-GGGGEXGXEXGAXXGXGEXRGXGWXG 754 G GE GG G G GG G G G G G G G Sbjct: 52 GYGGESGGGYGGGSGEGAGGGYGGAEGYASGGGSGHGGGGGG 93 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GG G GGGG G G G G G G G Sbjct: 93 GAASSGGYASGAGEGGGGGYGGAAGGHAGGGGGGSGGGGGSAYG 136 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG GGGG G G+ G G G+ G G Sbjct: 108 GGGGYGGAAGGHAGGGGGGSGGG-GGSAYGAGGEHASGYGNGAG 150 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGA--XXGXGEXRGXGWXGGXG 745 G G GG G G GG G GA G G G GG G Sbjct: 111 GYGGAAGGHAGGGGGGSGGGGGSAYGAGGEHASGYGNGAGEGGGAG 156 >At5g48920.1 68418.m06052 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 205 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/45 (42%), Positives = 19/45 (42%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P P P P P S P PPPP PPPSP PH Sbjct: 19 PLPSPVPPPPSHISPPPPPFSPPHHPPPPHFSPPHQPPPSPY-PH 62 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/43 (44%), Positives = 19/43 (44%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP PL SP P P S PPPP P PPP PH Sbjct: 13 PPSHQHPLPSPVP--PPPSHISPPPPPFSPPHHPPPPHFSPPH 53 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/42 (42%), Positives = 19/42 (45%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P S P P PPPP P PPP +P Sbjct: 55 PPPSPYPHPHPPPPS-PYPHPHQPPPP--PHVLPPPPPTPAP 93 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P S P P SP P P P P P P Sbjct: 34 PPPPFSPPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQP 77 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/41 (39%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 752 PPXQPXPLXSPX--PXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P SP P +P P PPP P PPP P Sbjct: 41 PHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPP 81 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P P P P PPP P Sbjct: 45 PPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPHVLPP 86 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP P P P P S P PP P P PH Sbjct: 40 PPHHPPPPHFSPPHQPPPSPYPHPHPPPPSPYPHPHQPPPPPH 82 >At1g29380.1 68414.m03592 hypothetical protein Length = 228 Score = 39.1 bits (87), Expect = 0.004 Identities = 19/44 (43%), Positives = 21/44 (47%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G+ G GGG G GGGG G + GA G G G G G G Sbjct: 98 GDVGGGGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGG 141 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGG G G G G G G G Sbjct: 103 GGGGYGGGTPGGGGGGGGDTGAGAGGGGYGGGGDTGAGGGVGSG 146 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 P P P P +P P SAP SPPP P PPP SP Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSP 77 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPP-XXPXXXXPPPSPXSP 877 P P P P+ SP P S P + P SPPPP P PPP P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P +P P ++P SPPP P PPP+P Sbjct: 78 PPASPPPA-TPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P P S+P P SPPP P PPP SP Sbjct: 55 TTSPPPVTTAPPPANPPPPVSSP--PPASPPPATPPPVASPPPPVASP 100 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P+ +P P + + PPP P P P SP Sbjct: 35 TPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP-XXPXXXXPPPSPXSP 877 P P P P+ + P P +PPPP P PPP+ P Sbjct: 45 PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPP 89 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P P P+ + P + P P S PPP P PPP SP P Sbjct: 52 PPVTTSPPPVTTAPPPANPPP-PVSSPPPASPPPATPPPVASPPPP 96 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P+ +P P ++P + +P P P P PS P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPP 144 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P+ SP P + P P P P P P+P Sbjct: 88 PPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P +P P + P P + PP P P P SP Sbjct: 94 PPPVASPPP-ATPPPVATPPPAPLASPPAQVP-APAPTTKPDSP 135 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPX---PXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P PL SP P AP + P SP P P P PS +P Sbjct: 107 PVATPPPAPLASPPAQVPAPAPTTKPDSPSP--SPSSSPPLPSSDAP 151 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 P P P P +P P SAP SPPP P PPP SP Sbjct: 33 PPTPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSP 77 Score = 37.9 bits (84), Expect = 0.009 Identities = 20/48 (41%), Positives = 22/48 (45%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPP-XXPXXXXPPPSPXSP 877 P P P P+ SP P S P + P SPPPP P PPP P Sbjct: 65 PPPANPPPPVSSPPPASPPPATPPPVASPPPPVASPPPATPPPVATPP 112 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P +P P ++P SPPP P PPP+P Sbjct: 78 PPASPPPA-TPPPVASPPPPVASPPPATPPPVATPPPAP 115 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P P S+P P SPPP P PPP SP Sbjct: 55 TTSPPPVTTAPPPANPPPPVSSP--PPASPPPATPPPVASPPPPVASP 100 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P+ +P P + + PPP P P P SP Sbjct: 35 TPTTPPPAATPPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASP 82 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/45 (33%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP-XXPXXXXPPPSPXSP 877 P P P P+ + P P +PPPP P PPP+ P Sbjct: 45 PPPVSAPPPVTTSPPPVTTAPPPANPPPPVSSPPPASPPPATPPP 89 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P P P+ + P + P P S PPP P PPP SP P Sbjct: 52 PPVTTSPPPVTTAPPPANPPP-PVSSPPPASPPPATPPPVASPPPP 96 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/44 (31%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P+ +P P ++P + +P P P P PS P Sbjct: 101 PPATPPPVATPPPAPLASPPAQVPAPAPTTKPDSPSPSPSSSPP 144 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P+ SP P + P P P P P P+P Sbjct: 88 PPVASPPPPVASPPPATPPPVATPPPAPLASPPAQVPAPAP 128 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P +P P + P P + PP P P P SP Sbjct: 94 PPPVASPPP-ATPPPVATPPPAPLASPPAQVP-APAPTTKPDSP 135 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPX---PXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P PL SP P AP + P SP P P P PS +P Sbjct: 107 PVATPPPAPLASPPAQVPAPAPTTKPDSPSP--SPSSSPPLPSSDAP 151 >At1g49490.1 68414.m05547 leucine-rich repeat family protein / extensin family protein contains similarity to disease resistance protein GI:3894383 from [Lycopersicon esculentum]; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 847 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/46 (43%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS--APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P +P SPPPP P PPPS P Sbjct: 582 PPPPSPPPPVHSPPPPPVFSPPPPVFSPPPP-SPVYSPPPPSHSPP 626 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P +P P PPP P PPPSP Sbjct: 576 PPPVASPPPPSPPPPVHSPPPPPVFSPPP--PVFSPPPPSP 614 Score = 35.5 bits (78), Expect = 0.049 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPX--SAPXSXPXSPPPPXX-----PXXXXPPPSPXSP 877 P P P P P+ SP P S P SPPPP P PPPSP P Sbjct: 539 PMPSPSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPP 590 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSPXSP 877 PP QP P+ SP P S S P SPPPP PPP SP Sbjct: 534 PPPQP-PMPSPSPPSPIYSPPPPVHSPPPPVYSSP--PPPHVYSP 575 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/49 (38%), Positives = 20/49 (40%), Gaps = 4/49 (8%) Frame = +2 Query: 746 PXPPX--QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSPH 880 P PP P P+ SP P S S P P P PPP SP H Sbjct: 595 PPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSPPPTH 643 Score = 31.9 bits (69), Expect = 0.60 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXPX---SAPXSXPXSPPPPXX-PXXXXPPPSPXSP 877 P PP P P+ SP P S P SPPPP P PPP SP Sbjct: 543 PSPPSPIYSPPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSP 594 Score = 31.9 bits (69), Expect = 0.60 Identities = 22/53 (41%), Positives = 23/53 (43%), Gaps = 9/53 (16%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPX--SAPXSXPX-SPPPP---XXPXXXXPPPSPXSP 877 P PP P P+ SP P S P P SPPPP P PPP SP Sbjct: 587 PPPPVHSPPPPPVFSPPPPVFSPPPPSPVYSPPPPSHSPPPPVYSPPPPTFSP 639 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 5/46 (10%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSP 868 P PP P P+ S P S P SPPPP P PP P Sbjct: 552 PPPPVHSPPPPVYSSPPPPHVYSPPPPVASPPPPSPPPPVHSPPPP 597 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSA-PXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP + P A P SPPPP PPP P P Sbjct: 499 PPNEAQGPTPDDPYDASPVKNRRSPPPPKVEDTRVPPPQPPMP 541 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 P PP P P S P PPP P P PPP SP Sbjct: 559 PPPPVYSSP-PPPHVYSPPPPVASPPPPSPPPPVHSPPPPPVFSP 602 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 4/45 (8%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPP----PXXPXXXXPPPSPXSP 877 P P P P ++P P SPPP P P PPP SP Sbjct: 567 PPPPHVYSPPPPVASPP--PPSPPPPVHSPPPPPVFSPPPPVFSP 609 >At1g68725.1 68414.m07853 arabinogalactan-protein, putative (AGP19) non-consensus splice site at the intron:exon boundary (AT:exon) Length = 247 Score = 38.3 bits (85), Expect = 0.007 Identities = 22/50 (44%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQPX---PLXSPXPXSAPXSXPXSPPP---PXXPXXXXPPPSPXSP 877 P PP P P SP P S P + P SPPP P PPP+P SP Sbjct: 98 PQPPQSPPASAPTVSPPPVSPPPA-PTSPPPTPASPPPAPASPPPAPASP 146 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPP---PXXPXXXXPPPSPXSP 877 P P P+ P ++P P SPPP P PPP+P SP Sbjct: 109 PTVSPPPVSPPPAPTSPPPTPASPPPAPASPPPAPASPPPAPVSP 153 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPLXSPX--PXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 P P P +P P + P P SPP P P PPP+P SP Sbjct: 79 PTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSPPPAPTSP 125 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSA-PXSXPXSPPPPXXPXXXXPPPSP 868 T P P P SP P A P P SPPP P PP+P Sbjct: 123 TSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPISLPPAP 168 Score = 33.1 bits (72), Expect = 0.26 Identities = 20/42 (47%), Positives = 21/42 (50%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP SP P SAP P PP P PPP+P SP Sbjct: 96 PPPQPPQ--SP-PASAPTVSP--PPVSPPPAPTSPPPTPASP 132 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP--PPXXPXXXXP--PPSPXSP 877 PP P P P AP P +PP PP P P P P SP Sbjct: 73 PPPAVTPTSPPAPKVAPVISPATPPPQPPQSPPASAPTVSPPPVSP 118 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/44 (38%), Positives = 17/44 (38%), Gaps = 1/44 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSA-PXSXPXSPPPPXXPXXXXPPPSPXS 874 P P P SP P A P P SPPP PSP S Sbjct: 120 PAPTSPPPTPASPPPAPASPPPAPASPPPAPVSPPPVQAPSPIS 163 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P + P AP S P +P P PP SP Sbjct: 119 PPAPTSPPPTPASPPP-APASPPPAPASPPPAPVSPPPVQAPSP 161 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/43 (32%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSPXSP 877 PP P + P +P P P P PPP+P SP Sbjct: 97 PPQPPQSPPASAPTVSPPPVSPPPAPTSPPPTPASPPPAPASP 139 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 38.3 bits (85), Expect = 0.007 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P PP P + +P P P +PPPP P PPP P P Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPP 556 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P PP P +P P P +PPPP P PPP P P Sbjct: 524 PPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPP 569 Score = 36.3 bits (80), Expect = 0.028 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P +P P P +PPPP P PSP Sbjct: 537 PPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSP 577 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P SAP P PPPP PPP P P Sbjct: 492 PPPPTPPAFKPLKGSAP---PPPPPPPLPTTIAAPPPPPPPP 530 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/50 (34%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = +2 Query: 734 TXXXPXPPXQP--XPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P + P P P + PPPP P PP P P Sbjct: 519 TIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPP 568 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P PL S P P PP PPP P P Sbjct: 418 PPPPPPPPPLSFIKTASLPLPSPPPTPPIADIAISMPPPPPPPP 461 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P PL P +AP P PPPP PPP P Sbjct: 509 PPPPPPPL--PTTIAAP---PPPPPPPRAAVAPPPPPPP 542 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P AP P PP P PP P P Sbjct: 456 PPPPPPPPPAVMPLKHFAPPPPPPL-PPAVMPLKHFAPPPPTPP 498 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P + PPPP P P P P Sbjct: 538 PPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMP 581 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 2/50 (4%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 T P P P P + S P P PPPP PPP P P Sbjct: 432 TASLPLPSPPPTPPIADIAISMPPPPPPPPPPPAVMPLKHFAPPPPPPLP 481 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/49 (32%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP-----XXXXPPPSPXSP 877 P PP P +P P P +P PP P PPP P P Sbjct: 550 PPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMP 598 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQPX--PLXS-----PXPXSAPXSXPXSPPPPXXPXXXX-PPPSPXSP 877 P PP P PL P P P + PPPP P PPP P P Sbjct: 492 PPPPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPP 543 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPX-PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP Q P P P S PPPP P P P P Sbjct: 566 PPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPP 610 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSX-----PXSPPPPXXPXXXXPPPSPXSP 877 P PP P +P P P P PPPP PP P P Sbjct: 563 PPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPPPPPP 611 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/45 (42%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = +2 Query: 746 PXPPXQPXP-LXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSPXS 874 P P P P L P P + P S P P PPP P PP +P S Sbjct: 72 PPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPPLPTEAPPPANPVS 116 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/54 (37%), Positives = 21/54 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P PP P SP P + P P PP P PPP P SP S P Sbjct: 231 PPPPGSKRPTPSP-PSPSDSKRPVHPSPPSPPEETLPPPKP-SPDPLPSNSSSP 282 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXS-PPPPXXPXXXXPPPSPXSP 877 P PL SP P +P S + PPP P P PSP P Sbjct: 62 PPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSPPPEPSPPPP 103 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXP-PPSPXSP 877 P PP P L +P P S P P PP P P PP+ P Sbjct: 148 PPPPESPPSLPAPDPPSNPLPPPKLVPPSHSPPRHLPSPPASEIP 192 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P+ P S P P PPP P PP S P Sbjct: 85 PPPTTIPVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPP 126 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPX-SXPXSPPPPXXPXXXXPPPSPXS 874 P P P P S P + P S SPPPP P PP P S Sbjct: 193 PPPRHLPSPPASERPSTPPSDSEHPSPPPPGHPKRREQPPPPGS 236 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXP-----XXXXPPPSPXSP 877 P P+ SP P S+P P + PP P PPP P SP Sbjct: 109 PPPANPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPPPPPESP 154 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P +P P + S P PP P PP +P Sbjct: 98 PSPPP-PLPTEAPPPANPVSSPPPESSPPPPPPTEAPPTTP 137 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P +P +P + P PPPP P P P +P Sbjct: 125 PPPPPTEAPPTTPITSPSPPTNP--PPPPESPPSLPAPDPPSNP 166 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/50 (36%), Positives = 21/50 (42%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPSPXSP 877 P PP + P+ SP P + P P SP P P P PPP P Sbjct: 126 PPPPTEAPPTTPITSPSPPTNPPPPPESPPSLPAPDPPSNPLPPPKLVPP 175 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP + P P P P S SPP P PPSP Sbjct: 258 PSPPEETLPPPKPSPDPLP-SNSSSPPTLLPPSSVVSPPSP 297 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 2/44 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS--PXSP 877 P P S P P S P P P P PPP+ P SP Sbjct: 51 PETTNTPAQSSPPPETPLSSPPPEPSPPSPSLTGPPPTTIPVSP 94 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP +P P P + P SPPP P PPP P Sbjct: 71 PPPEPSPPSPSLTGPPPTTIPVSPPPEPSP----PPPLP 105 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/44 (43%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP-XSPPPPXXPXXXXPPPSPXS 874 P P P P P P AP + P SP PP P PP SP S Sbjct: 118 PPPESSPPP---PPPTEAPPTTPITSPSPPTNP--PPPPESPPS 156 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPX-SXPXSPPPPXXPXXXXPPPSPXSP 877 PP +P P P P AP + P S PPP PPP+ P Sbjct: 94 PPPEPSP-PPPLPTEAPPPANPVSSPPP-ESSPPPPPPTEAPP 134 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P SP P + P + P P PPP P Sbjct: 91 PVSPPPEPSPPPPLPTEAPPPANPVSSPPPESSPPPPP 128 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP-PSPXSP 877 P PP P P P P S +P PP P PSP SP Sbjct: 219 PPPPGHPKRREQPPP---PGSKRPTPSPPSPSDSKRPVHPSPPSP 260 >At1g02405.1 68414.m00187 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 134 Score = 37.9 bits (84), Expect = 0.009 Identities = 21/48 (43%), Positives = 21/48 (43%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS-APXSXPXSPPPP---XXPXXXXPPPSPXSP 877 P QP P SP P S P P SPPPP P PPP P P Sbjct: 43 PCLQNQPPPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPP 90 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 3/43 (6%) Frame = +2 Query: 746 PXPPXQPXP--LXSPXPXSAPXSXPXS-PPPPXXPXXXXPPPS 865 P PP P P SP P S P S PP P P PPP+ Sbjct: 50 PPPPSPPPPSCTPSPPPPSPPPPKKSSCPPSPLPPPPPPPPPN 92 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 37.5 bits (83), Expect = 0.012 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = +2 Query: 746 PXPPXQPXPLXS--PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P PP P P+ S P P P S PPP P PPP+ S Sbjct: 42 PSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSPPVITSPPPTVAS 86 Score = 36.3 bits (80), Expect = 0.028 Identities = 20/53 (37%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPP-----PXXPXXXXPPPSPXSP 877 T P QP +P P + P S P SPPP P P PPPS P Sbjct: 19 TTAPPPLQTQPTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPP 71 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSP--XPXSAPXSXPXSPPPP---XXPXXXXPPPSP 868 P P P P+ P P S P SPPPP P PPPSP Sbjct: 29 PTTPSAPPPVTPPPSPPQSPPPVVSSSPPPPVVSSPPPSSSPPPSP 74 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP + P P + + SPPPP P +P P Sbjct: 146 PSPPGETPSPPKPSPSTPTPTTTTSPPPPPATSASPPSSNPTDP 189 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P + P S P P P P PSP +P Sbjct: 123 PSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTP 163 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/39 (33%), Positives = 16/39 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P SP ++P S PPP PP +P Sbjct: 64 PPPSSSPPPSPPVITSPPPTVASSPPPPVVIASPPPSTP 102 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/40 (32%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS-APXSXPXSPPPPXXPXXXXPPPSP 868 PP P P + +P P + P P P PPP P Sbjct: 98 PPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKP 137 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 4/44 (9%) Frame = +2 Query: 746 PXPPX----QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P PP P P SP P S P P P P P P+ Sbjct: 123 PSPPAPTTTNPPPKPSPSPPGETPSPPGETPSPPKPSPSTPTPT 166 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP----XSPPPPXXPXXXXPPPSPXSP 877 PP P + SP P A P SPPP PP SP Sbjct: 70 PPPSPPVITSPPPTVASSPPPPVVIASPPPSTPATTPPAPPQTVSP 115 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 4/43 (9%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP----XSPPPPXXPXXXXPPPSP 868 PP P + P P A S P +PPP P PSP Sbjct: 106 PPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSPPGETPSP 148 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/54 (27%), Positives = 22/54 (40%), Gaps = 3/54 (5%) Frame = +2 Query: 755 PXQPXPLXSPXPXS---APXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P + SP P + P + P + PP P PP+P + + S P Sbjct: 88 PPPPVVIASPPPSTPATTPPAPPQTVSPPPPPDASPSPPAPTTTNPPPKPSPSP 141 >At5g08230.1 68418.m00965 PWWP domain-containing protein putative transcription factor (HUA2) - Arabidopsis thaliana, EMBL:AF116556 Length = 1445 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P PL P S P P SPPPP P P P P Sbjct: 1119 PSFPAGSPPLPHESPPSPPPQPPSSPPPPSSPPQLAPAPPP 1159 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/44 (38%), Positives = 21/44 (47%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP QP SP P S+P +PPP PP +P +P Sbjct: 1134 PSPPPQPPS--SPPPPSSPPQLAPAPPPSDH--CLPPPTAPLAP 1173 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXP-PPSPXSPH 880 P P P P P P P P PPP P P PP P +P+ Sbjct: 127 PYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAPCPPPPPTPY 172 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP-----PPXXPXXXXPPPSP 868 P PP P P P + P P +PP PP P PPP+P Sbjct: 113 PPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTP 158 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P PPP PPP+P +P Sbjct: 89 PPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP 130 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P PPP PPP+P +P Sbjct: 97 PPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTP 138 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/48 (37%), Positives = 21/48 (43%), Gaps = 3/48 (6%) Frame = +2 Query: 734 TXXXPXPPX---QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 T P PP P P+ +P P P P +P PP P PPP P Sbjct: 134 TPYTPPPPTVKPPPPPVVTPPP---PTPTPEAPCPPPPPTPYPPPPKP 178 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS-APXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P PPPP P P+P +P Sbjct: 121 PPPPPTPYTPPPPTPYTPPPPTVKPPPPPVVTPPPPTPTPEAP 163 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 P PP P P + P P P PP PP P PPP P Sbjct: 76 PPPPYTPKP-PTVKPPPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKP 121 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP----XXPXXXXPPPSP 868 P PP P P P P +PPPP P PPP P Sbjct: 105 PPPPPYVKPPPPPTVKPPPPPTPYTPPPPTPYTPPPPTVKPPPPP 149 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSA---PXSXPXSPPP--PXXPXXXXPPPSPXSP 877 P PP P +P P + P P PPP P P PPP P Sbjct: 49 PKPPTVKPPTHTPKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKP 97 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPX-QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP +P P P P P + PP P PPP P Sbjct: 61 PKPPTVKPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPPTVKP 105 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 P PP P P P P P PP PP P PPP P Sbjct: 68 PPPPYIPCP-PPPYTPKPPTVKPPPPPYVKPPPPPTVKPPPPPYVKP 113 >At3g11030.1 68416.m01331 expressed protein contains Pfam domain PF03005: Arabidopsis proteins of unknown function Length = 451 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P S P P SPPPP P PPPSP P Sbjct: 67 PPPTSPP---PPSPPPPSPPPPSPPPPSPPPP 95 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/38 (50%), Positives = 20/38 (52%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 PP P P SP P S P P SPPPP P PPP+ Sbjct: 64 PP--PPPPTSPPPPSPP---PPSPPPPSPPPPSPPPPA 96 Score = 36.3 bits (80), Expect = 0.028 Identities = 14/26 (53%), Positives = 14/26 (53%) Frame = +2 Query: 800 PXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P SPPPP P PPPSP P Sbjct: 65 PPPPPTSPPPPSPPPPSPPPPSPPPP 90 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP 841 P PP P P SP P S P P SPPPP P Sbjct: 66 PPPPTSPPP-PSPPPPSPP---PPSPPPPSPP 93 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +2 Query: 812 PXSPPPPXXPXXXXPPPSPXSP 877 P PPP P PPPSP P Sbjct: 64 PPPPPPTSPPPPSPPPPSPPPP 85 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 37.5 bits (83), Expect = 0.012 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P SP P + P PPPP PPP P Sbjct: 59 PPPPSPPPP--SPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/35 (40%), Positives = 16/35 (45%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P + +P P S P P PPP P PPP P Sbjct: 53 PSCIQNPPPPSPPPPSP--PPPACPPPPALPPPPP 85 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P P S PPPP PP P Sbjct: 69 PPPPACPPPPALPPPPPKKVSSYCPPPPPANFLYITGPPGNLYP 112 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 37.1 bits (82), Expect = 0.016 Identities = 21/53 (39%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXS----APXSXPXSPP-PPXXPXXXXPPPSPXSP 877 T P PP P P P P S A S P +PP PP P PP P +P Sbjct: 724 TSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAP 776 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P PP P P+ P P +PP P P PPP P P Sbjct: 689 PPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTPIVHTSSPPPPPPPP 734 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P S P PPPP PPP+P +P Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPP-------PPPAPPTP 742 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P P +P P SPPPP P PP+P S Sbjct: 708 PPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQS 744 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP 841 P PP P P S+P P PPPP P Sbjct: 709 PPPPAPPAPPTPIVHTSSPPPPPPPPPPPAPP 740 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P SP P +AP PPPP P P P Sbjct: 758 PAPPRLPTHSASPPPPTAP------PPPPLGQTRAPSAPPPPPP 795 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP 841 T P PP P +P ++ P PPPP P Sbjct: 704 TKVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPPAP 739 Score = 28.7 bits (61), Expect = 5.6 Identities = 18/59 (30%), Positives = 21/59 (35%), Gaps = 5/59 (8%) Frame = +2 Query: 746 PXPPXQPXPLX---SPXPXSAPXSXPXSPPPP--XXPXXXXPPPSPXSPHXXXXXSLLP 907 P PP P P+ SP P P P P P PP+P +P S P Sbjct: 712 PAPPAPPTPIVHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASP 770 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 37.1 bits (82), Expect = 0.016 Identities = 18/44 (40%), Positives = 21/44 (47%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P +P P + P SPPPP P P P+P P Sbjct: 129 PTPPVSPPP-PTPTPSVPSPTPPVSPPPPT-PTPSVPSPTPPVP 170 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P +P P + P SPPPP P P SP Sbjct: 93 PTPPVSPPP-PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 135 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P +P P + P SPPPP P P SP Sbjct: 111 PTPPVSPPP-PTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 153 Score = 36.3 bits (80), Expect = 0.028 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP + SP P P SPPPP P P PS SP Sbjct: 153 PPPPTPTPSVPSPTPP-VPTDPMPSPPPPVSPPPPTPTPSVPSP 195 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/44 (34%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P+ SP P +P +P P P PP+P P Sbjct: 165 PTPPVPTDPMPSPPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVP 208 Score = 35.5 bits (78), Expect = 0.049 Identities = 18/48 (37%), Positives = 19/48 (39%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P P P P + P SPPPP P P SP Sbjct: 73 TPPAPVPPVSPPP---PTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSP 117 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP-SPXSP 877 P P P+ P P P +PP P P PPP SP P Sbjct: 142 PSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPPVSPPPP 186 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P+ P P P S P SP PP P P PS SP Sbjct: 88 PSVPSPTPPVSPPPPTPTP-SVP-SPTPPVSPPPPTPTPSVPSP 129 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P+ P P P S P SP PP P P PS SP Sbjct: 106 PSVPSPTPPVSPPPPTPTP-SVP-SPTPPVSPPPPTPTPSVPSP 147 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/44 (40%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P+ P P P S P SP PP P P PS SP Sbjct: 124 PSVPSPTPPVSPPPPTPTP-SVP-SPTPPVSPPPPTPTPSVPSP 165 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPPPSPXSP 877 P PP + SP P +P +P P P P P PSP P Sbjct: 135 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMPSPPPP 180 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/54 (25%), Positives = 19/54 (35%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P PP P P +P +PP P P P+P +P + P Sbjct: 177 PPPPVSPPPPTPTPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPSVPSPPDVTP 230 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P S + P S P P P P PP SP P Sbjct: 96 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP-SPTPPVSPPPP 138 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P S + P S P P P P PP SP P Sbjct: 114 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP-SPTPPVSPPPP 156 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P S + P S P P P P P P+ P Sbjct: 132 PVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVPTDPMP 175 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/44 (29%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP + SP P +P +P P PPP +P Sbjct: 99 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTP 142 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/47 (34%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPP-PSPXSP 877 P PP + SP P +P +P P P P PP P+P P Sbjct: 117 PPPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPPPPTPTPSVP 163 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP +P S P P P PP P PP P Sbjct: 204 TPSVPSPPDVTPTPPTPSVPSPPDVTPTPPTPPSVPTPSGSPPYVPPP 251 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/48 (31%), Positives = 19/48 (39%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP +P S P P +PP P P P+P +P Sbjct: 189 TPSVPSPPDVTPTPPTPSVPSPPDVTP-TPPTPSVPSPPDVTPTPPTP 235 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 37.1 bits (82), Expect = 0.016 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX-SAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P +P P PPP P PPP SP Sbjct: 713 PPPPVHSPPPPVHSPPPPVQSPPPPPVFSPPPPAPIYSPPPPPVHSP 759 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX-SAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ SP P +P SPPPP P PPP+P Sbjct: 706 PPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPP--PVFSPPPPAP 747 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPXSAPXSXPXSPP--PPXXPXXXXPPPSPXSP 877 P PP Q P P+ SP P AP P PP P P PPP SP Sbjct: 727 PPPPVQSPPPPPVFSP-PPPAPIYSPPPPPVHSPPPPVHSPPPPPVHSP 774 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ SP P P PPP P PPPSP Sbjct: 767 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP--PVHSPPPPSP 807 Score = 33.9 bits (74), Expect = 0.15 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX-SAPXSXPXSPPPPXX-----PXXXXPPPSPXSP 877 P PP P P+ SP P +P SPPPP P PPP P +P Sbjct: 774 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPSPIYSPPPPVFSPPPKPVTP 825 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/43 (37%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P P P ++P S P PPP P PPP SP P Sbjct: 624 PQPPSPSTEETKTTSPQSPPVHSPPPPPPVHSPPPPVFSPPPP 666 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX--SAPXSXPXSPPPPXX---PXXXXPPPSPXSP 877 P PP P P+ SP P S P SPPPP P PPP SP Sbjct: 663 PPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 713 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQ--PXPLXS-PXPXSAPXSXPXSPPPP---XXPXXXXPPPSPXSP 877 P PP P P+ S P P +P SPPPP P PPP SP Sbjct: 685 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSP 734 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPX--QPXPLXSPXPXS-APXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P PP P P+ SP P +P SPPPP P PPP SP P Sbjct: 656 PPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPP--PVHSPPPPVHSPPPP 702 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = +2 Query: 746 PXPPXQ--PXPLXS-PXPXSAPXSXPXSPPPP---XXPXXXXPPPSP 868 P PP P P+ S P P +P SPPPP P PPP P Sbjct: 692 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVQSPPPPP 738 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P P PPP P PPP SP Sbjct: 699 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP--PVQSPPPPPVFSP 742 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 2/44 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 PP P P P +P SPPPP P PPP SP P Sbjct: 743 PPPAPIYSPPPPPVHSPPPPVHSPPPP--PVHSPPPPVHSPPPP 784 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXS-APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P +P SPPPP P SP P Sbjct: 649 PPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPPVHSPPPP 695 Score = 31.9 bits (69), Expect = 0.60 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 746 PXPPXQ---PXPLXS-PXPXSAPXSXPXSPPPP---XXPXXXXPPPSPXSP 877 P PP P P+ S P P +P SPPPP P PPP SP Sbjct: 677 PPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 727 Score = 31.9 bits (69), Expect = 0.60 Identities = 20/51 (39%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXS--APXSXPXSPPPPXX---PXXXXPPPSPXSP 877 P PP P P+ SP P +P SPPPP P PPP SP Sbjct: 752 PPPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 802 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 755 PXQPXPLXSPXPXS-APXSXPXSPPPPXX---PXXXXPPPSP 868 P P P+ SP P +P SPPPP P PPP P Sbjct: 647 PPPPPPVHSPPPPVFSPPPPMHSPPPPVYSPPPPVHSPPPPP 688 Score = 31.1 bits (67), Expect = 1.1 Identities = 20/47 (42%), Positives = 21/47 (44%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPLXSPXPX--SAPXSXPXSPPPPXX---PXXXXPPPSPXSP 877 PP P P+ SP P S P SPPPP P PPP SP Sbjct: 751 PP--PPPVHSPPPPVHSPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 795 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +2 Query: 755 PXQPXPLXSPXPXS-APXSXPXSP-PPPXXPXXXXPPPS 865 P P P+ SP P +P P +P PP P P PS Sbjct: 802 PPPPSPIYSPPPPVFSPPPKPVTPLPPATSPMANAPTPS 840 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 37.1 bits (82), Expect = 0.016 Identities = 17/44 (38%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXP---XXXXPPPSPXS 874 PP P +P P P P +PPPP P PPP P S Sbjct: 385 PPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMS 428 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/45 (35%), Positives = 17/45 (37%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 T P P P SP P P + PPPP PPP P Sbjct: 368 TANAPPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 33.5 bits (73), Expect = 0.20 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P +PPPP P P P P Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPP 413 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP + P +P P P PPPP PP P +P Sbjct: 397 PPPPPKKGPA-APPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNP 439 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P Q +P P + PPPP PPP P Sbjct: 360 PLTPGQFTTANAPPAPPGPANQTSPPPPPPPSAAAPPPPPP 400 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/52 (28%), Positives = 17/52 (32%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSL 901 P P P P P + P PPP PP +P P SL Sbjct: 399 PPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKGPTKSGETSL 450 >At3g24480.1 68416.m03070 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 494 Score = 36.7 bits (81), Expect = 0.021 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P P P S P S P PPP P PPP Sbjct: 412 PPPPPSPPLPPPVYSPPPSPPVFSPPPSPPVYSPPPP 448 Score = 36.3 bits (80), Expect = 0.028 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX-SPPPPXXPXXXXPPPSP 868 P PP P SP S P S P SPPPP PPP P Sbjct: 419 PLPPPVYSPPPSPPVFSPPPSPPVYSPPPPPSIHYSSPPPPP 460 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/41 (43%), Positives = 18/41 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P S P P PPP P PPPSP Sbjct: 403 PSPPIVALP--PPPPPSPPLPPPVYSPPPSPP-VFSPPPSP 440 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/39 (46%), Positives = 19/39 (48%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P+ SP P P SPPPP PPPSP Sbjct: 436 PPPSP-PVYSPPP--PPSIHYSSPPPPPVHHSSPPPPSP 471 >At4g27850.1 68417.m03999 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 577 Score = 36.3 bits (80), Expect = 0.028 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P P +P P SP P P P P P P Sbjct: 238 PTPGPDSPLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPP 282 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P PL P P +P P SP P P P P P Sbjct: 191 PSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSPLPLPGP 232 Score = 35.5 bits (78), Expect = 0.049 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P PL P P +P P SP P P P P P Sbjct: 165 PPPPPYPSPLPPP-PSPSPTPGPDSPLPSPGPDSPLPLPGP 204 Score = 34.7 bits (76), Expect = 0.086 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS-APXSXPXSP-PPPXXPXXXXPPPSPXSP 877 P PP P P +P P S P P SP P P P P P P SP Sbjct: 202 PGPPPSPSP--TPGPDSPLPSPGPDSPLPLPGPPPSSSPTPGPDSP 245 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P PL P P S+P P SP P PPPSP Sbjct: 219 PSPGPDSPLPLPGPPPSSSPTPGPDSPLPSPG-----PPPSP 255 Score = 34.3 bits (75), Expect = 0.11 Identities = 20/46 (43%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS-APXSXPXSP-PPPXXPXXXXPPPSPXSP 877 P PP P P +P P S P P SP P P P P P P SP Sbjct: 173 PLPPP-PSPSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSP 217 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P +P P SP P P P P P SP Sbjct: 161 PPLPPP---PPPYPSPLPPPPSPSPTPGPDSPLPSPGPDSP 198 Score = 32.3 bits (70), Expect = 0.46 Identities = 20/47 (42%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPXSA-PX-SXPXSPPPPXXPXXXXPPPSPXSP 877 P P P PL SP P S P P SP P P P P P SP Sbjct: 180 PSPTPGPDSPLPSPGPDSPLPLPGPPPSPSPTPGPDSPLPSPGPDSP 226 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P SP P P P SP P P P P P Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSPGP 288 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPXSAPXSXPXSPP-PPXXPXXXXPPPSPXSP 877 P P P PL SP P S P P PP P P PSP P Sbjct: 208 PSPTPGPDSPLPSPGPDS-PLPLPGPPPSSSPTPGPDSPLPSPGPP 252 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPP--PXXPXXXXPP-PSPXSPH 880 P P P SP P P S SP P P PP PSP PH Sbjct: 245 PLPSPGPPPSPSPTPGPDSPLPSPGPDSPLPSPGPDPPLPSP-GPH 289 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 3/41 (7%) Frame = +2 Query: 755 PXQPXPLXSPXPX---SAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P+ SP P S P P PPP P PPP P Sbjct: 501 PPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPP 541 Score = 35.5 bits (78), Expect = 0.049 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPSP 868 PP P P+ SP P S S P P PPP P PPP P Sbjct: 493 PP--PPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPP 532 Score = 34.7 bits (76), Expect = 0.086 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P PP P P+ SP P P PPP P PPP SP P Sbjct: 588 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPP 635 Score = 34.7 bits (76), Expect = 0.086 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 2/42 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPS 865 P PP PL P S P P + PPP P PPPS Sbjct: 662 PPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPS 703 Score = 34.3 bits (75), Expect = 0.11 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 PP P P+ SP P S P PP PP P PPP SP Sbjct: 510 PP--PPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSP 552 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P SP S P SPPPP PPP SP Sbjct: 494 PPPPVHSPPPPSPI-HSPPPPPVYSPPPPPPVYSPPPPPPVYSP 536 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/46 (39%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P PP P P S P P PPP P PPP SP P Sbjct: 510 PPPPPVYSPPPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPP 555 Score = 33.5 bits (73), Expect = 0.20 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPX--QPXPLXSPXPXS-APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P +P SPPPP P PPP SP Sbjct: 625 PPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPP--PVKSPPPPPVYSP 669 Score = 33.1 bits (72), Expect = 0.26 Identities = 21/51 (41%), Positives = 22/51 (43%), Gaps = 7/51 (13%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX--SAPXSXPXSPPPPXX---PXXXXPPPSPXSP 877 P PP P P+ SP P S P SPPPP P PPP SP Sbjct: 566 PPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 616 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/50 (40%), Positives = 22/50 (44%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQ--PXPLXS-PXPXSAPXSXPXSPPPP---XXPXXXXPPPSPXSP 877 P PP P P+ S P P +P SPPPP P PPP SP Sbjct: 538 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSP 587 Score = 32.7 bits (71), Expect = 0.35 Identities = 21/49 (42%), Positives = 23/49 (46%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX-SAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P PP P P+ SP P +P SPPPP P PPP SP P Sbjct: 559 PPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPP--PVHSPPPPVHSPPPP 605 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/45 (40%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +2 Query: 755 PXQPXPLXSPXPX-SAPXSXPXSPPPPXX---PXXXXPPPSPXSP 877 P P P+ SP P +P SPPPP P PPP SP Sbjct: 536 PPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 580 Score = 32.3 bits (70), Expect = 0.46 Identities = 19/47 (40%), Positives = 21/47 (44%), Gaps = 6/47 (12%) Frame = +2 Query: 746 PXPPXQ--PXPLXS-PXPXSAPXSXPXSPPPP---XXPXXXXPPPSP 868 P PP P P+ S P P +P SPPPP P PPP P Sbjct: 545 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPP 591 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P P PPP P PPP SP Sbjct: 552 PPPPVHSPPPPVHSPPPPVHSPPPPVHSPPP--PVYSPPPPPVHSP 595 Score = 32.3 bits (70), Expect = 0.46 Identities = 22/52 (42%), Positives = 23/52 (44%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX--SAPXSXPX-SPPPPXX---PXXXXPPPSPXSP 877 P PP P P+ SP P S P P SPPPP P PPP SP Sbjct: 595 PPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSP 646 Score = 32.3 bits (70), Expect = 0.46 Identities = 21/52 (40%), Positives = 22/52 (42%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPX---SPPPPXX---PXXXXPPPSPXSP 877 P PP P P+ SP P S P SPPPP P PPP SP Sbjct: 602 PPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSP 653 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQ--PXPLXS-PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ S P P +P SPPPP P SP P Sbjct: 618 PPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPP 664 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 3/44 (6%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 P P P+ SP P S P PP PP P PPP SP Sbjct: 518 PPPPPPVYSPPPPPPVYSPPPPPPVHSPP--PPVHSPPPPVHSP 559 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 4/42 (9%) Frame = +2 Query: 755 PXQPXPLXS-PXPXSAPXSXPXSPPPP---XXPXXXXPPPSP 868 P P P+ S P P +P SPPPP P PPP P Sbjct: 616 PPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPP 657 Score = 31.5 bits (68), Expect = 0.80 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPX--SAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P+ SP P S P SPPPP PP SP Sbjct: 632 PPPPVHSPPPPVYSPPPPVYSPPPPPVKSPPPPPVYSPPLLPPKMSSP 679 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/50 (34%), Positives = 22/50 (44%), Gaps = 5/50 (10%) Frame = +2 Query: 746 PXPPXQPXP--LXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSPXSPH 880 P PP QP + SP P S+P + P +P P P P P P+ Sbjct: 433 PPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPNDPY 482 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX-SPPPP---XXPXXXXPPPSPXSP 877 P PP P P S P P SPPPP P PPP SP Sbjct: 519 PPPPPVYSPPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 566 Score = 30.7 bits (66), Expect = 1.4 Identities = 19/51 (37%), Positives = 21/51 (41%), Gaps = 6/51 (11%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXS--APXSXPXSPPPPXX--PXXXXPPPSPXSPH 880 P PP P P+ SP P +P SPPPP P PP P H Sbjct: 573 PPPPVHSPPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVH 623 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 P P P+ SP P S P P P PPP SP P Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 569 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/53 (37%), Positives = 21/53 (39%), Gaps = 9/53 (16%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPX--SAPXSXPXSPP----PPXXPXXXXPPPSPXSP 877 P PP P P+ SP P S P PP PP P PPP SP Sbjct: 580 PPPPVYSPPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSP 632 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/50 (32%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS------APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP + P S +P P PPP P PPP SP Sbjct: 469 PQPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSP 518 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPL--XSPXPXSAPXSXPXSPPPP---XXPXXXXPPPSPXSP 877 PP P P P +P SPPPP P PPP SP Sbjct: 527 PPPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSP 573 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/49 (36%), Positives = 18/49 (36%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP---PXXPXXXXPPP--SPXSP 877 P PP P P S P PPP P P PPP SP P Sbjct: 528 PPPPPVYSPPPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPP 576 >At1g56530.1 68414.m06501 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 185 Score = 35.9 bits (79), Expect = 0.037 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P S P PPP P PPP P Sbjct: 146 PPPPESPPPESLPPPSPESPSPPSPEPPP--PSSLEPPPPP 184 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +2 Query: 812 PXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P SPPP P PSP SP SL P Sbjct: 149 PESPPPESLPPPSPESPSPPSPEPPPPSSLEP 180 Score = 29.5 bits (63), Expect = 3.2 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 821 PPPPXXPXXXXPPPSPXSP 877 PPP P PPPSP SP Sbjct: 147 PPPESPPPESLPPPSPESP 165 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 35.9 bits (79), Expect = 0.037 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +2 Query: 779 SPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 S P P S P PPPP P PPP P P Sbjct: 32 SQDPPLFPQSPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 33.5 bits (73), Expect = 0.20 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPX--PLXSPXPXSAPXSXPXSPPPPXXPXXXXP---PPSPXSP 877 P PP PL SP P P P S PPP P P PP P SP Sbjct: 77 PPPPVTDMIKPLSSPPPPQPP---PRSQPPPKPPQKNLPRRHPPPPRSP 122 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 16/44 (36%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP---XXPXXXXPPPSP 868 P P P P P P P P PPPP PPP P Sbjct: 36 PLFPQSPPPPPPPPPPPPPPPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +2 Query: 761 QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 Q PL P P P PPPP P PPP P Sbjct: 33 QDPPLFPQSPPPPPPPPPPPPPPPPPP----PPPPP 64 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXS--PPPPXXPXXXXPPPSPXSP 877 P PP P P P P + S PPPP P SP P Sbjct: 49 PPPPPPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPP 94 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/44 (34%), Positives = 15/44 (34%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP---PXXPXXXXPPPSP 868 P PP P P S P PPP P PPP P Sbjct: 53 PPPPPPPPPPPPAVNMSVETGIPPPPPPVTDMIKPLSSPPPPQP 96 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 35.5 bits (78), Expect = 0.049 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P PPP P PPP+P SP Sbjct: 67 PPPPPIYSPPPPPIYPPPIYSPPPPPIYPPPIYSPPPTPISP 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P+ P P S P + PPP P PPP P P Sbjct: 42 PPPPPYRSPVTIPPPPPV-YSRPVAFPPP--PPIYSPPPPPIYP 82 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 761 QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 QP P P +P + P PP P PPP SP Sbjct: 37 QPIYSPPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSP 75 >At2g27390.1 68415.m03306 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 35.5 bits (78), Expect = 0.049 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P P P P P P P PPPP P PPP+ Sbjct: 78 PLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPPPA 117 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 746 PXPPXQPXPLXS-PXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P P P PL P P P P PPP P PPP Sbjct: 76 PPPLFPPPPLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 Score = 32.7 bits (71), Expect = 0.35 Identities = 20/54 (37%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP-PPXXPXXXXPPP-SPXSPHXXXXXSLLP 907 PP P P S P P PP PP P PPP P P LLP Sbjct: 41 PPPSPPPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLPPPLLP 94 Score = 32.7 bits (71), Expect = 0.35 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPX--QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P PL P P P P PPP P PPP P Sbjct: 68 PLPPRFELPPPLFPPPPL--PRLPPPLLPPPEEPPREPPPPPP 108 Score = 31.5 bits (68), Expect = 0.80 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP--PPXXPXXXXPPPSPXSPHXXXXXSLLP 907 PP PL P +P P SPP PP P PP P P L P Sbjct: 29 PPPLVFPLLPLSPPPSPPPSPSSPPRLPPPFP-ALFPPEPPLPPRFELPPPLFP 81 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P L P P P P P P PPP P P Sbjct: 46 PPSPSSPPRLPPPFPALFPPEPPLPPRFELPPPLFPPPPLPRLP 89 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P P PP P PPP P Sbjct: 77 PPLFPPP---PLPRLPPPLLPPPEEPPREPPPPPPPPEEPPP 115 >At2g30560.1 68415.m03722 glycine-rich protein Length = 171 Score = 35.1 bits (77), Expect = 0.065 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G G+GGG G GGG G G G G+ G G GG Sbjct: 10 GGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSGGGGGGGG 51 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/42 (40%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = -2 Query: 867 GEGG-GXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G+GG G G GGGG G G G G G G G G Sbjct: 3 GKGGSGSGGGGKGGGGGGSGGGRGGGGGGGAKGGCGGGGKSG 44 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G GGG G GGGG G G G G + G GG Sbjct: 76 GSGGGGKGGG--GGGGISGGGAGGKSGCGGGKSGGGGGG 112 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXG 781 G GGG G GGGG G + G G G Sbjct: 109 GGGGGKNGGGCGGGGGGKGGKSGGGSGGG 137 Score = 28.3 bits (60), Expect = 7.4 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGG--GEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GG G G + G G G+ G G GG G Sbjct: 80 GGKGGGGGGGISGGGAGGKSGCGGGKSGGGGGGGK-NGGGCGGGGG 124 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P + P P P S P PPP PPPSP P Sbjct: 514 PPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPPPPSPSPP 557 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/45 (40%), Positives = 20/45 (44%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP P SP P S+ S PP P PPPSP P+ Sbjct: 501 PPPPPPPEYEPSPPPPSSEMSPSVRAYPPPPPL-SPPPPSPPPPY 544 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P P P SP PP PPP P Sbjct: 529 PPPPLSPPPPSPPPPYIYSSPPPPSPSPPPPYIYSSPPPVVNCP 572 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/43 (41%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX--SPPPPXXPXXXXPPPSP 868 P P P SP P S P SPPPP P PP SP Sbjct: 721 PSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTPVEYHPPASP 763 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/41 (34%), Positives = 14/41 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P PPPP PPP P Sbjct: 596 PSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPP 636 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/51 (37%), Positives = 22/51 (43%), Gaps = 6/51 (11%) Frame = +2 Query: 734 TXXXPXPPXQPXP-LXSPXPXS---APXSXPXSPPPPXX--PXXXXPPPSP 868 T P PP P + SP P +P + PPPP P PPPSP Sbjct: 644 TASPPPPPVYYTPVIQSPPPPPVYYSPVTQSPPPPPPVYYPPVTQSPPPSP 694 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXP---XSPPPP---XXPXXXXPPPSPXSP 877 T P PP P+ P +P P SPPPP P PP P +P Sbjct: 701 TQSPPPPPVYYLPVTQSPPPPSPVYYPPVAKSPPPPSPVYYPPVTQSPPPPSTP 754 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 5/46 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX--SPPPPXX---PXXXXPPPSP 868 P PP + SP P P SPPPP P PPP P Sbjct: 620 PPPPPTYYAVQSPPPPPPVYYPPVTASPPPPPVYYTPVIQSPPPPP 665 >At1g10620.1 68414.m01204 protein kinase family protein contains serine/threonine protein kinases active-site signature, PROSITE:PS00108 Length = 718 Score = 35.1 bits (77), Expect = 0.065 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P + P PP P PPPSP P Sbjct: 60 PP--PATAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQP 99 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P P SP ++P + PPP P PPP+P S Sbjct: 44 PATSPPSPPSPDTQTSPPPATAAQPPPNQPPNTTPPPTPPS 84 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/45 (35%), Positives = 18/45 (40%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 T P QP P P + P + P SPPP P P P P Sbjct: 58 TSPPPATAAQPPP-NQPPNTTPPPTPPSSPPPSITPPPSPPQPQP 101 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/37 (45%), Positives = 19/37 (51%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP QP P +P P + P S P S PP P PPP Sbjct: 69 PPNQP-PNTTPPP-TPPSSPPPSITPPPSPPQPQPPP 103 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/48 (29%), Positives = 15/48 (31%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P P +P P P P P P P P Sbjct: 76 TTPPPTPPSSPPPSITPPPSPPQPQPPPQSTPTGDSPVVIPFPKPQLP 123 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPX---SXPXSPPPPXXPXXXXP 856 T P P P P P S+P + P SPP P P P Sbjct: 64 TAAQPPPNQPPNTTPPPTPPSSPPPSITPPPSPPQPQPPPQSTP 107 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 PP P P P P P +PPP PPP P P SL P Sbjct: 371 PPPVPAP-QMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P P P P P P S PPPP P PPP Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP--XXPXXXXPPPSP 868 P PP P P P P PPPP P PP P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P S P P P P PP P P +P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPP--PPMSLGPKAPRPP 427 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.7 bits (76), Expect = 0.086 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 PP P P P P P +PPP PPP P P SL P Sbjct: 371 PPPVPAP-QMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGP 421 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P P P P P P S PPPP P PPP Sbjct: 377 PQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPP 415 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP--XXPXXXXPPPSP 868 P PP P P P P PPPP P PP P Sbjct: 388 PPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P S P P P P PP P P +P P Sbjct: 386 PRPPPPAPPPGSGGPKPPPPPGPKGPRPP--PPMSLGPKAPRPP 427 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 34.7 bits (76), Expect = 0.086 Identities = 22/58 (37%), Positives = 24/58 (41%), Gaps = 3/58 (5%) Frame = +2 Query: 746 PXPPXQPXPLX---SPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLPL 910 P PP P PL +P P P +PPPP P P P P S SL PL Sbjct: 28 PLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPP----PLPRPCSRPPKTKCSLKPL 81 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P PP P P P +PPPP P PPP P P Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPPLMRRRAPPPPPPPP 63 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/36 (36%), Positives = 13/36 (36%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PL P P P PPPP PP P P Sbjct: 14 PLPPPPPPLMRRRAPLPPPPPPPLMRRRAPPPPPPP 49 >At4g15200.1 68417.m02329 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 600 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PL P SAP P + PPP P P P P P Sbjct: 255 PLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/39 (41%), Positives = 18/39 (46%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P +P P P P P PP P PPP+P Sbjct: 265 PP--PPPAAAPPP-QPPPPPPPKPQPPPPPKIARPPPAP 300 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP + P S P + P PPPP P PPP Sbjct: 254 PPLKLPPGRSAPPPPPAAAPPPQPPPPPPPKPQPPPP 290 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 34.7 bits (76), Expect = 0.086 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -2 Query: 906 GRREXXXXXXGEXGEGGGXXXXGXXGGGGEXG---XEXGAXXGXGEXRGXGWXGGXG 745 GRRE G G GGG G GGGG G E G G GE G G GG G Sbjct: 106 GRREGG---GGYSGGGGGYSSRG--GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 157 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 867 GEGGGXXXXGXX-GGGGEXGXEXGAXXGXGEXRGXGW 760 G GGG G GGGG G E G G G G GW Sbjct: 125 GGGGGSYGGGRREGGGGYGGGEGGGYGGSG--GGGGW 159 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 34.7 bits (76), Expect = 0.086 Identities = 25/57 (43%), Positives = 25/57 (43%), Gaps = 3/57 (5%) Frame = -2 Query: 906 GRREXXXXXXGEXGEGGGXXXXGXXGGGGEXG---XEXGAXXGXGEXRGXGWXGGXG 745 GRRE G G GGG G GGGG G E G G GE G G GG G Sbjct: 123 GRREGG---GGYSGGGGGYSSRG--GGGGSYGGGRREGGGGYGGGEGGGYGGSGGGG 174 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GG G G G E G G+ GG G Sbjct: 94 GHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREG-GGGYSGGGG 136 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = -2 Query: 867 GEGGGXXXXGXX-GGGGEXGXEXGAXXGXGEXRGXGW 760 G GGG G GGGG G E G G G G GW Sbjct: 142 GGGGGSYGGGRREGGGGYGGGEGGGYGGSG--GGGGW 176 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGW--XGGXG 745 G GGG G GGG G G G G G G GG G Sbjct: 88 GSGGGGGHRGGGGGGYRSGGGGGYSGGGGSYGGGGGRREGGGG 130 >At1g52030.2 68414.m05870 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P +P P AP P S P P P P+P Sbjct: 293 PAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAP 333 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P P P +P P AP P P P P+P P+ Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPPN 335 >At1g52030.1 68414.m05869 myrosinase-binding protein, putative (F-ATMBP) identical to SP|Q9SAV1 Myrosinase binding protein-like f-AtMBP [Arabidopsis thaliana]; similar to myrosinase binding protein GI:1711295 from [Brassica napus]; contains Pfam PF01419: Jacalin-like lectin domain; identical to cDNA myrosinase-binding protein-like protein (MBP1.2) GI:6760446 Length = 642 Score = 34.7 bits (76), Expect = 0.086 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P +P P AP P S P P P P+P Sbjct: 293 PAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAP 333 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/45 (31%), Positives = 17/45 (37%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P P P +P P AP P P P P+P P+ Sbjct: 291 PLPAPTPAPAPAPAPAPAPAPSPAPASAPVPAPAPTPAPAPAPPN 335 >At4g22470.1 68417.m03245 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to hydroxyproline-rich glycoprotein DZ-HRGP from Volvox carteri f. nagariensis GP|6523547; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 375 Score = 34.3 bits (75), Expect = 0.11 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSP 868 PP P P + P + P P PPP P PPP P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPP 108 Score = 34.3 bits (75), Expect = 0.11 Identities = 16/54 (29%), Positives = 20/54 (37%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P P P P S P + PPP PPP+ P ++ P Sbjct: 78 PPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITPPLSPPPPAITP 131 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/42 (35%), Positives = 19/42 (45%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP P P P + + P + PP P PPP +P Sbjct: 45 PPPQPDP-QPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTP 85 Score = 33.1 bits (72), Expect = 0.26 Identities = 17/42 (40%), Positives = 19/42 (45%), Gaps = 3/42 (7%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSA--PXSXPXSP-PPPXXPXXXXPPPSP 868 P P P +P P A P + P P PPP P PPP P Sbjct: 121 PLSPPPPAITPPPPLATTPPALPPKPLPPPLSPPQTTPPPPP 162 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P + P +P +PPPP PP P P Sbjct: 102 TTPPPPPAITPPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPP 149 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P PP P SP P + P + PP P PPP Sbjct: 112 PPPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPP 150 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP PL P P P + PP P PP SP Sbjct: 113 PPPPAITPPLSPPPPAITPPPPLATTPPALPPKPLPPPLSP 153 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P S P + PPP P PP SP Sbjct: 132 PPPLATTPPALPPKPLPPPLSPPQTTPPP--PPAITPPLSP 170 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P +P P P + PPP P PPP+ P Sbjct: 92 PLPPPLSPPQTTPPP---PPAITPPPPPAITPPLSPPPPAITPP 132 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/52 (36%), Positives = 22/52 (42%), Gaps = 8/52 (15%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPXSAPXSXPX--SPP---PPXXPXXXXPPPSPXSP 877 P PP Q P P+ + P P P SPP PP P PPP +P Sbjct: 69 PPPPPQSTSPPPVATTPPALPPKPLPPPLSPPQTTPPPPPAITPPPPPAITP 120 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP----PXXPXXXXPPPSPXSP 877 P P P +P P A + P SPPP P P PP P P Sbjct: 100 PQTTPPPPPAITPPPPPA-ITPPLSPPPPAITPPPPLATTPPALPPKP 146 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP----XXPXXXXPPPSPXSP 877 P P P P P AP + PPPP P PP P P Sbjct: 45 PPPQPDPQPPTPPTFQPAPPANDQPPPPPQSTSPPPVATTPPALPPKP 92 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P S P P PPP P PPP +P Sbjct: 248 PQGFSCPGPSPTISPPPLPPQTLKPPPPQTTP 279 >At4g01985.1 68417.m00265 expressed protein Length = 579 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GG G G G G G G G GG G Sbjct: 59 GGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAG 102 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G GGG G G G G G G GG G Sbjct: 530 GSGGASGGAGAGGGAGGGVGGGANVGVGVGAGGSTGGGAAGGGG 573 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G G GG G G G G G G GG G Sbjct: 65 GGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGGASGGAG-GGGKG 107 Score = 31.9 bits (69), Expect = 0.60 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G G G G G G G G G GG G Sbjct: 450 GAVGGGGGGSVGGGGRGSGGAGGGTGGSVGAGGGVGVGGGGGIG 493 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G GG G G G G G G GG G Sbjct: 316 GSGGASGGASGGASGGAGGSVGAGGGVGGGVGGGVGGGVGGGVG 359 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GG G GGGG G G G G G G G G Sbjct: 56 GASGGIGVGGGGGGGGGIGGSGGVGAGGGVGGGAGGAIGGG 96 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/47 (38%), Positives = 18/47 (38%), Gaps = 3/47 (6%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXG---GGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G G G GGG G G G G G G GG G Sbjct: 75 GSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVG 121 Score = 31.1 bits (67), Expect = 1.1 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G+ G G G G G GG G GA G G G G G G Sbjct: 165 GKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIGSG-GGGTVGAGG 207 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGE-XGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G G G G GG G Sbjct: 100 GAGGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 141 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G G GG G GA G G G G GG G Sbjct: 456 GGGSVGGGGRGSG--GAGGGTGGSVGAGGGVGVGGGGGIGGGAG 497 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG GGG G G G G G G GG G Sbjct: 466 GSGGAGGGTGGSVGAGGGVGVGGGGGIGGGAGGGVGGGVGGGVG 509 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG G GGG G G G G G GG G Sbjct: 158 GGGKGRGGKSGGGAGGGVGGGVGAGGGAGGSVGAGGGIG 196 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G G GGG G G+ G G RG G G G Sbjct: 221 GAGGRGSGGASGGVGVGGGAGGSGGGSVGGGG--RGSGGVGASG 262 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G+G G G GGG G G G G G GG G Sbjct: 102 GGGGKGRGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAG 145 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G G G G G GG G GA G G G GG Sbjct: 113 GGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGG 151 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G GGGG GA G G G G GG G Sbjct: 237 GGGAGGSGGGSVGGGGRGSGGVGASGGAGGNVGAG--GGLG 275 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G G GG G GA G G G G G Sbjct: 239 GAGGSGGGSVGGGGRGSGG-VGASGGAGGNVGAGGGLGGGVGGG 281 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG GGGG G G G G G G GG G Sbjct: 52 GAGGGASGGIGVGGGGGGGGGIGGSGGVGAGGGVG--GGAG 90 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G GG G G G G G G G G G Sbjct: 84 GVGGGAGGAIGGGASGGAGGGGKGRGRKGGGGAGGGVGGGVGAG 127 Score = 29.1 bits (62), Expect = 4.3 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 1/56 (1%) Frame = -2 Query: 909 RGRREXXXXXXGEXGE-GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 RGR+ G G G G G G GG G G G G G G GG G Sbjct: 108 RGRKGGGGAGGGVGGGVGAGGGAGGSVGAGGGIGGGAGGAIGGGASGGVG-GGGKG 162 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEX-RGXGWXGGXG 745 G G GG G GGG GA G G +G G GG G Sbjct: 71 GGIGGSGGVGAGGGVGGGAGGAIGGGASGGAGGGGKGRGRKGGGG 115 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G G GG G G G G G GG G Sbjct: 178 GVGAGGGAGGSVGAGGGIGSGGGGTVGAGGRGSGGASGGGG 218 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGG-EXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G G GG G GA G G G G G G Sbjct: 304 GGGGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGG 345 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXG--XGEXRGXGWXGGXG 745 G GGG G GG G GA G G G G GG G Sbjct: 374 GGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVGGAGGAG 419 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GG G GA G G G G G Sbjct: 306 GGGSVGGGGRGSGGASGGASGGASGGAGGSVGAGGGVGGGVGGG 349 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/42 (38%), Positives = 16/42 (38%), Gaps = 1/42 (2%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGG-EXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G G GG G GA G G GG G Sbjct: 372 GGGGGSVGGGGRGSGGASGGASGGASGGASGGASGGASGGVG 413 >At3g22120.1 68416.m02792 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 334 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/47 (38%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP---PPPXXPXXXX--PPPSPXSP 877 PP +P P P P S P P PPP P PPP+P P Sbjct: 119 PPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPP 165 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P P + P PP P PPP+P Sbjct: 128 PKPPTKPPPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTP 168 Score = 33.9 bits (74), Expect = 0.15 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 9/54 (16%) Frame = +2 Query: 746 PXPPXQPXPLXSPX----PXSAPXSXPXSP--PPPXXPXXXX--PPPS-PXSPH 880 P PP +P P P P P S P P PPP P PPPS P PH Sbjct: 102 PKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKPPTTKPPPSTPKPPH 155 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/42 (35%), Positives = 18/42 (42%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPX-QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P P P P +PP P P P P+P Sbjct: 151 PKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTP 192 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPX--SPPPPXXPXXXXPPPSPXSP 877 T P PP P +P + P P +PP P P P P+P +P Sbjct: 196 TPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPPVVTPPTPTPPTP 245 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPX-QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP +P P P P P PP P PP+P P Sbjct: 139 PKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTPPTPTPP 183 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAP--XSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P P PPP PPPS P Sbjct: 99 PPHPKPPTKPHPHPKPPIVKPPTKPPPSTPKPPTKPPPSTPKP 141 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 PP P P + P S P PPP P P P P +P Sbjct: 135 PPSTPKPPTTKPPPSTPKPPHHKPPPTPCPPPTPTPTPPVVTP 177 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/41 (31%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P +PP P P P P+P Sbjct: 162 PCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTP 202 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP----PSPXSP 877 PP P P +P P + P PP P PP P+P P Sbjct: 158 PPPTPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPP 203 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P +P + P P PP PP+P P Sbjct: 186 TPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPPVVTPPTPTPP 233 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/44 (29%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P +P + P P PP PP+P P Sbjct: 170 PTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPP 213 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/48 (29%), Positives = 17/48 (35%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P +P + P P PP PP+P P Sbjct: 176 TPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTPTPPVITPPTPTPP 223 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 2/50 (4%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSP 877 T P P P+ +P + P P +P PP PP +P +P Sbjct: 161 TPCPPPTPTPTPPVVTPPTPTPPVITPPTPTPPVVTPPTPTPPVITPPTP 210 >At2g28490.1 68415.m03462 cupin family protein similar to preproMP27-MP32 [Cucurbita cv. Kurokawa Amakuri] GI:691752, allergen Gly m Bd 28K [Glycine max] GI:12697782, vicilin [Matteuccia struthiopteris] GI:1019792; contains Pfam profile PF00190: Cupin Length = 511 Score = 34.3 bits (75), Expect = 0.11 Identities = 21/54 (38%), Positives = 21/54 (38%) Frame = -2 Query: 906 GRREXXXXXXGEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G E GE G G G GGGG G G G GE G G GG G Sbjct: 30 GEEEWGGAGGGEWGGAEGGGAWGGGGGGG--GAWGGEGEGGGEWGGGGEGGGGG 81 >At2g25050.1 68415.m02996 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 1111 Score = 34.3 bits (75), Expect = 0.11 Identities = 18/46 (39%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P P P P+ S P SA + SP PP P PPP P P Sbjct: 533 PQCPQSPTPVHSNGPPSAEAAVTSSPLPPLKPLRILSRPPPPPPPP 578 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P PL S + P PP PPP P P Sbjct: 601 PPPPPPPPPLQSHRSALSSSPLPPPLPPKKLLATTNPPPPPPPP 644 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +2 Query: 746 PXPPXQPXPLXS----PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP P P+ S P P S S PPP PPP P H Sbjct: 571 PPPPPPPPPISSLRSTPSPSSTSNSIATQGPPP------PPPPPPLQSH 613 >At1g17790.1 68414.m02202 DNA-binding bromodomain-containing protein similar to SP|P13709 Female sterile homeotic protein (Fragile-chorion membrane protein) {Drosophila melanogaster}; contains Pfam profile PF00439: Bromodomain Length = 487 Score = 34.3 bits (75), Expect = 0.11 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXP 856 P P P+ P P P P SPPPP P P Sbjct: 253 PAPAPSIAPIVEPLPAIVPSPSPSSPPPPPPPPVAAP 289 >At1g02710.1 68414.m00222 glycine-rich protein Length = 96 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GEGGG G GGGG+ + G G G + GG G Sbjct: 44 GGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGG 87 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/42 (40%), Positives = 18/42 (42%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G GEGGG GGGG G + G G G G GG Sbjct: 54 GGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGGEGDGGG 95 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/51 (35%), Positives = 20/51 (39%), Gaps = 7/51 (13%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXG-------XEXGAXXGXGEXRGXGWXGGXG 745 G+ GGG G GGGGE G G G G+ G GG G Sbjct: 39 GQWLHGGGGEGGGGEGGGGEGGGGQKISKGGGGGGSGGGQRSSSGGGGGGG 89 >At5g25550.1 68418.m03040 leucine-rich repeat family protein / extensin family protein similar to leucine-rich repeat/extensin 1 (GI:13809918) [Arabidopsis thaliana]; contains Pfam PF00560: Leucine Rich Repeat domains Length = 433 Score = 33.9 bits (74), Expect = 0.15 Identities = 19/45 (42%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +2 Query: 752 PPXQPXPLXSPX-PXSAPXSXPXSPPP---PXXPXXXXPPPSPXS 874 PP Q P P P +P S P S PP P P PPP P S Sbjct: 383 PPSQISPSSQPLAPAPSPTSPPLSTPPPARPCPPVYSPPPPPPLS 427 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 33.9 bits (74), Expect = 0.15 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP +P P SP P +P S PPP P PPP Sbjct: 45 PPSKPSPSMSPPP--SPSLPLSSSPPPPPPHKHSPPP 79 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/37 (35%), Positives = 13/37 (35%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P S P PP P P PPP P H Sbjct: 39 PTICSPPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKH 75 Score = 29.9 bits (64), Expect = 2.4 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 6/48 (12%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPX-----SPPPP-XXPXXXXPPPSPXSP 877 PP P SP P S S P PPPP PPP P SP Sbjct: 67 PPPPPPHKHSPPPLSQSLSPPPLITVIHPPPPRFYYFESTPPPPPLSP 114 >At5g10430.1 68418.m01209 arabinogalactan-protein (AGP4) identical to gi_3883126_gb_AAC77826 Length = 135 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P P P P+ +P P + P P +PPP P PPS Sbjct: 37 PPPVATPPPVATPPPAATP--APATPPPAATPAPATTPPS 74 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P +P P P + P +P P P PS SP Sbjct: 66 PAPATTP-PSVAPSPADVPTASPPAPEGPTVSPSSAPGPSDASP 108 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/40 (35%), Positives = 18/40 (45%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P P P P +P P + P +PPP P PPP+ Sbjct: 26 PTPTATPPPA-TPPPVATPPPV-ATPPPAATPAPATPPPA 63 >At5g04970.1 68418.m00526 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 624 Score = 33.9 bits (74), Expect = 0.15 Identities = 15/43 (34%), Positives = 18/43 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP QP P + P S P + PP P PSP P+ Sbjct: 43 PPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSPSQPSPLPPN 85 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP P S P + P + PP P PP SP Sbjct: 35 PPIQPSSQPPTQPPSQPPTQPPTQPPSHPPTQPPTPPPSQSP 76 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P S P + P S P + PP P PP P +P Sbjct: 31 PPSHPPIQPSSQPPTQPPSQPPTQPPTQPP--SHPPTQPPTP 70 >At1g70460.1 68414.m08107 protein kinase, putative contains Pfam PF00069: Protein kinase domain Length = 710 Score = 33.9 bits (74), Expect = 0.15 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPX-SAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P + SP P S+P P PP P PP SP P Sbjct: 49 PALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPP 93 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P SP P AP P PPP PP S SP Sbjct: 78 PPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSP---PPESTNSP 118 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/43 (37%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P+ P P +P + PPP P PPP P Sbjct: 90 PPPPDAPPPIPIVFPPPIDSPPPESTNSPPP--PEVFEPPPPP 130 Score = 32.3 bits (70), Expect = 0.46 Identities = 15/42 (35%), Positives = 18/42 (42%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P S+P P P P PP+P +P Sbjct: 137 PPAPPPPEQLPPPASSPQGGP-KKPKKHHPGPATSPPAPSAP 177 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P S P +PPP P PPP P Sbjct: 62 PPTVSSPPPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIP 100 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS--APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P+ SP P S +P PPP PP+P P Sbjct: 98 PIPIVFPPPIDSPPPESTNSPPPPEVFEPPPPPADEDESPPAPPPP 143 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPP--PPXXPXXXXPPPS 865 P P SP SAP + P +PP PP PP S Sbjct: 165 PGPATSPPAPSAPATSPPAPPNAPPRNSSHALPPKS 200 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP---PSPXS 874 P PP P P P S P PP P PP P P S Sbjct: 69 PPPPLDSSPPPPPDLTPPPSSPPPPDAPPPIPIVFPPPIDSPPPES 114 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP----PPXXPXXXXPPPSPXSP 877 P P P P S P + P PP PP PPP SP Sbjct: 30 PPPTDSAPPPSPPADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSP 77 Score = 27.9 bits (59), Expect = 9.8 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPX--SPPP-----PXXPXXXXPPPSP 868 PP P P S P + P P SPPP P P PPP P Sbjct: 37 PPPSP-PADSSPPPALPSLPPAVFSPPPTVSSPPPPPLDSSPPPPP 81 >At5g59170.1 68418.m07416 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 288 Score = 33.5 bits (73), Expect = 0.20 Identities = 17/47 (36%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 746 PXPPXQPXPLXS-PXPXSAPXSXPXSPPPPXX-PXXXXPPPSPXSPH 880 P P +P P+ P P P PPPP P PPP PH Sbjct: 50 PYSPPKPPPIEKYPPPVQYPPPIKKYPPPPYEHPPVKYPPPIKTYPH 96 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/47 (31%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP---XXPXXXXPPPSPXSP 877 P PP + P+ P P P PPP P PPP P Sbjct: 76 PPPPYEHPPVKYPPPIKTYPHPPVKYPPPEQYPPPIKKYPPPEQYPP 122 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P P PPPP PPP P Sbjct: 22 PLPPPPPPP---PPPMRRRAPLPPPPPPPMRRRAPLPPPPP 59 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/48 (33%), Positives = 17/48 (35%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP----XXPXXXXPPPSPXSP 877 P P + PL P P P PPPP PPP P P Sbjct: 31 PPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPPPPLP 78 >At4g16980.1 68417.m02560 arabinogalactan-protein family similar to arabinogalactan protein [Arabidopsis thaliana] gi|10880495|gb|AAG24277; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 33.5 bits (73), Expect = 0.20 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P+ SP P P P +PP P PPP P +P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPP----PMPMTPPPMPMAP 83 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 5/49 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS-APXSXPXSPPP-PXXP---XXXXPPPSPXSP 877 P P P P+ +P P P P +PPP P P PP P +P Sbjct: 50 PPPVMSPMPMMTPPPMPMTPPPMPMTPPPMPMAPPPMPMASPPMMPMTP 98 >At3g24550.1 68416.m03083 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 652 Score = 33.5 bits (73), Expect = 0.20 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 5/46 (10%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPP---PSPXSP 877 P P P S S P S P P PPP P PP PSP +P Sbjct: 40 PSSPPPSPSTNSTSPPPSSPLPPSLPPPSPPGSLTPPLPQPSPSAP 85 Score = 33.5 bits (73), Expect = 0.20 Identities = 18/43 (41%), Positives = 21/43 (48%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP P L P P +P S P +P PP P P SP SP+ Sbjct: 66 PPSPPGSLTPPLPQPSP-SAPITPSPP-SPTTPSNPRSPPSPN 106 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPX-PXSAPXSXPXSPPPPXXPXXXXPPPSP 868 T P P P +P P +P + SPPP PPPSP Sbjct: 24 TTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLPPSLPPPSP 69 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/53 (33%), Positives = 20/53 (37%), Gaps = 5/53 (9%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSA-----PXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P PP P + P A P + P SPPP PPPS P Sbjct: 9 TTPSPSPPSPPTNSTTTTPPPAASSPPPTTTPSSPPPSPSTNSTSPPPSSPLP 61 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P P P P PPSP +P Sbjct: 55 PPSSPLPPSLPPPSPPGSLTPPLPQPSPSAPITPSPPSPTTP 96 >At1g75550.1 68414.m08780 glycine-rich protein Length = 167 Score = 33.5 bits (73), Expect = 0.20 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGGG G G G G G GW GG G Sbjct: 60 GGSGSYRWGWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGG 100 Score = 32.3 bits (70), Expect = 0.46 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G G GGG G GGGG G G G G G GG Sbjct: 71 GGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/45 (40%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXG----WXGGXG 745 G GGG G GGGG G G G G G G W G G Sbjct: 68 GWGGGGGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCGGG 112 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGGG G G G G G GG G Sbjct: 73 GGGGGGGGGGGGGGGGGGGGWGWGGGGGGGGWYKWGCG-GGGKG 115 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRG 769 G G GGG G GGGG G G G+ +G Sbjct: 82 GGGGGGGGGGGWGWGGGGGGGGWYKWGCGGGGKGKG 117 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGW 760 G G GGG G GGGG G G G G GW Sbjct: 68 GWGGGGGGGGGGGGGGGGG--GGGGGGWGWGGGGGGGGW 104 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/43 (41%), Positives = 19/43 (44%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P PP P PL P P S +PPPP P PPP S Sbjct: 311 PPPPPPPPPLLQQPP--PPPSVSKAPPPPPPP----PPPKSLS 347 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP + P P P P PPPP PPP P P Sbjct: 304 PPQKSIP--PPPPPPPPPLLQQPPPPPSVSKAPPPPPPPPPP 343 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P PP P P P P PPPP PPP P S Sbjct: 310 PPPPPPPPPPLLQQPPPPPSVSKAPPPPP-------PPPPPKS 345 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP 832 P PP P PL P SA P +P P Sbjct: 29 PLPPPPPPPLKPPSSGSATTKPPINPSKP 57 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P S P P P PP P PP P P Sbjct: 303 PPPQKSIPPPPPPPPPPLLQQPPPPPSVSKAPPPPPPP 340 >At4g12480.1 68417.m01973 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein identical to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 168 Score = 33.1 bits (72), Expect = 0.26 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P +P P P P +P P P P P P P +P Sbjct: 32 PSPKHKPVPSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTP 75 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAP-XSXPXSPPPPXXPXXXXPPPSPXS 874 P P +P P+ SP P P S P P P PP +P S Sbjct: 38 PVPSPKPKPVPSPKPKPVPSPSVPSPSVPSPNPRPVTPPRTPGS 81 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P P P P P SP P P P PS SP+ Sbjct: 32 PSPKHKPVPSPKPKPVP-SPKPKPVPSPSVPSPSVPSPN 69 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 33.1 bits (72), Expect = 0.26 Identities = 18/44 (40%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPX-SPPPPXXPXXXXPPP 862 T P PP P +P P S P P SPPPP PPP Sbjct: 95 TSISPNPPA-PIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPP 137 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P PP P P P +PPPP PPP Sbjct: 110 PPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPPPP 148 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 2/47 (4%) Frame = +2 Query: 746 PXPPXQPXPLXS--PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P P L S P P + S SP PP P PP P +P+ Sbjct: 72 PNPNPNPPVLGSSPPSPTDSSSSTSISPNPPA-PIVNPNPPPPSTPN 117 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP SP S+ S +PP P PP +P P Sbjct: 76 PNPPVLGSSPPSPTDSSSSTSISPNPPAPIVNPNPPPPSTPNPP 119 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 2/45 (4%) Frame = +2 Query: 746 PXPPXQPXP--LXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P P P P L + P + PPPP P PP +P S Sbjct: 118 PPPEFSPPPPDLDTTTAPPPPSTDIPIPPPPPAPVSASPPLTPPS 162 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP 829 P PP P P+ + P + P S SP P Sbjct: 143 PIPPPPPAPVSASPPLTPPSSVVTSPAP 170 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 33.1 bits (72), Expect = 0.26 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 1/34 (2%) Frame = +2 Query: 770 PLXSPXPXS-APXSXPXSPPPPXXPXXXXPPPSP 868 P SP P P P PPP P PPPSP Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSP 83 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/46 (34%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSP--XPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P P P +P P PPP P P P P Sbjct: 63 PPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPPRP 108 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/40 (37%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P P P P +PPPP P PP PSP H Sbjct: 50 PAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSPSPEPEH 89 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P L P P P P PP PPP P P Sbjct: 69 PPPPPPPQSLPPPSPSPEPEHYPP-PPYHHYITPSPPPPRPLPP 111 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +2 Query: 779 SPXPXSAPXSXPXSPPPPXXPXXXXPPPS--PXSP 877 SP P P PPPP P PP S P SP Sbjct: 49 SPAPSPEPEDYLPLPPPPQTPPPPPPPQSLPPPSP 83 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/46 (34%), Positives = 16/46 (34%), Gaps = 5/46 (10%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXS-----PPPPXXPXXXXPPPSP 868 P PP P P P S P P PPPP PP P Sbjct: 61 PLPPPPQTPPPPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP 106 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 7/46 (15%) Frame = +2 Query: 746 PXPPXQ--PXPLXSPXPXSAPXS-----XPXSPPPPXXPXXXXPPP 862 P PP Q P P SP P P SPPPP P PPP Sbjct: 71 PPPPPQSLPPPSPSPEPEHYPPPPYHHYITPSPPPP-RPLPPPPPP 115 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P P PPP P PP SP Sbjct: 79 PPPSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHFSSP 122 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 33.1 bits (72), Expect = 0.26 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPP-PPXXPXXXXPPPSPXSP 877 P + P P P S P PP P P PPPSP P Sbjct: 35 PLEETPPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPP 76 Score = 32.3 bits (70), Expect = 0.46 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P P P P P P P PPP P Sbjct: 40 PPVDPSPSSVHRPYPPPPPLPDFAPQPLLPPPSPPPPPP 78 Score = 31.1 bits (67), Expect = 1.1 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP 832 P PP P P +P P P S P PPPP Sbjct: 52 PYPPPPPLPDFAPQPLLPPPSPP--PPPP 78 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 32.7 bits (71), Expect = 0.35 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P P P P P P P PPPP P PPP Sbjct: 214 PHSPFPPPP-PGPPPKEQDFVRPPLPPPPQLPQSSQPPP 251 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 GGG G GGGG G G G G G G GG Sbjct: 122 GGGFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGG 158 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGG G G G G G G G Sbjct: 152 GSGGYGGGAGGYGGNSGGGYGGNAAGGYGGSGAGGYGGDATGHG 195 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G G GG G GA G G GG G Sbjct: 124 GFGGGGYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYG 164 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGG----GEXGXEXGAXXGXGEXRGXGWXG 754 G G GGG G GGG G G G G G G G+ G Sbjct: 129 GYGGGGGGYGGSGGYGGGAGGYGGSGGYGGGAGGYGGNSGGGYGG 173 >At5g14920.1 68418.m01750 gibberellin-regulated family protein similar to SP|P46689 Gibberellin-regulated protein 1 precursor {Arabidopsis thaliana}; contains Pfam profile PF02704: Gibberellin regulated protein Length = 275 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/41 (39%), Positives = 19/41 (46%), Gaps = 3/41 (7%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 P P P P ++P P +PP PP P PP SP P Sbjct: 127 PTPTVKP-PTTSPVKPPTTPPVQSPPVQPPTYKPPTSPVKP 166 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPX---PLXSPX--PXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP P SP P + P P + PP P PP +P P Sbjct: 150 PPVQPPTYKPPTSPVKPPTTTPPVKPPTTTPPVQPPTYNPPTTPVKP 196 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP P P P S P P P SP P Sbjct: 100 PPVQPPTYKPPTPTVKPPSVQPPTYKPPTPTVKPPTTSPVKP 141 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P+ P P P S PP P P P +P Sbjct: 71 PPTTKPPVKPPTIPVTPVKPPVSTPPIKLPPVQPPTYKPPTP 112 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 32.7 bits (71), Expect = 0.35 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP 841 P PP P P+ P P S PPPP P Sbjct: 22 PLPPPPPPPMRRSAPSPPPMSGRVPPPPPPPP 53 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +2 Query: 812 PXSPPPPXXPXXXXPPPSP 868 P PPPP P PPP P Sbjct: 148 PLPPPPPPMPRRSPPPPPP 166 >At4g39680.1 68417.m05614 SAP domain-containing protein contains Pfam domain PF02037: SAP domain Length = 633 Score = 32.7 bits (71), Expect = 0.35 Identities = 16/46 (34%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXP--LXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P QP L P P + P P + PP PPP P +P Sbjct: 545 PQPQHQPQAQTLSRPPPTALPPPPPLAKPPHVVERLPLPPPPPIAP 590 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/42 (33%), Positives = 14/42 (33%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP 859 T P P P P P P PPPP P PP Sbjct: 555 TLSRPPPTALPPPPPLAKPPHVVERLPLPPPPPIAPEEQEPP 596 >At4g33660.1 68417.m04781 expressed protein Length = 76 Score = 32.7 bits (71), Expect = 0.35 Identities = 14/31 (45%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 788 PXSAPXSXPXSPPPP-XXPXXXXPPPSPXSP 877 P AP + P PPPP P PPP P P Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPP 39 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P P P P P P PPPP P PPP Sbjct: 9 PYPAPGNYPQGPPPPVGVPPQYYPPPPPPPPP---PPPP 44 >At4g08370.1 68417.m01382 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 350 Score = 32.7 bits (71), Expect = 0.35 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 7/46 (15%) Frame = +2 Query: 752 PPXQPX----PLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 PP QP PL SP +P P SPPPP PPP P Sbjct: 35 PPPQPYVYSPPLPSPYVYKSPPPSPYLYSSPPPPPYVYNSPPPPPP 80 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P SP P P SPPPP PPP Sbjct: 86 PPRPPYVYKSPPP---PPFVYSSPPPPTYIYNSPPPP 119 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 32.7 bits (71), Expect = 0.35 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G+ GGG GGG G + G G G RG G GG G Sbjct: 65 GDGISGGGHGDGLGCSGGGGDGTKGGGRRGDGLGRGLGRGGGRG 108 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXG--AXXGXGEXRGXGWXGGXG 745 GGG G GGGG G + G G G G G GG G Sbjct: 44 GGGEGTSGEGGGGGGDGTKGGGDGISGGGHGDGLGCSGGGG 84 >At5g56330.1 68418.m07031 carbonic anhydrase family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains Pfam profile PF00194: Eukaryotic-type carbonic anhydrase Length = 350 Score = 32.3 bits (70), Expect = 0.46 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 T P P P P P P AP P P P P P+P P+ Sbjct: 49 TPPKPKPKPAPTP-PKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPN 96 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P P P AP P P P P P+P P Sbjct: 60 TPPKPKPAPAPTP-PKPKPAPAPTPPKPKPKPAPTPPNPKPTPAPTPP 106 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P AP P P P P P+P P Sbjct: 31 PKPAPAPTP-PKPKPTPAPTPPKPKPKPAPTPPKPKPAPAPTPP 73 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P +P P P P PP P PP P Sbjct: 26 PKPP-KPKPAPAPTPPK-PKPTPAPTPPKPKPKPAPTPPKP 64 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P P P P P P P P+P Sbjct: 29 PKPKPAPAPTP-PKPKPTPAPTPPKPKPKPAPTPPKPKPAP 68 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P +P P P P PP P PP P Sbjct: 37 PTPP-KPKPTPAPTPPK-PKPKPAPTPPKPKPAPAPTPPKP 75 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P P P +P P P P P+P Sbjct: 73 PKPKPAPAPTP-PKPKPKPAPTPPNPKPTPAPTPPKPKPAP 112 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P P P P P P P P P+P Sbjct: 40 PKPKPTPAPTP-PKPKPKPAPTPPKPKPAPAPTPPKPKPAP 79 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P +P P P P PP P PP P Sbjct: 70 PTPP-KPKPAPAPTPPK-PKPKPAPTPPNPKPTPAPTPPKP 108 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P +P P + + +PP P P P+P Sbjct: 81 PTPP-KPKPKPAPTPPNPKPTPAPTPPKPKPAPAPAPTPAP 120 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPX-QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP +P P +P P P P P P P P P P Sbjct: 48 PTPPKPKPKPAPTP-PKPKPAPAPTPPKPKPAPAPTPPKPKP 88 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXP-XSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P +P P P P PP P PP+P Sbjct: 55 PKPAPTPPKPKPAPAPTPPKPKPAPAPTPPKPKPKPAPTPPNP 97 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXP-PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P +P P + P P P P P P P+P P Sbjct: 66 PAPAPTPPKPKPAPAP-TPPKPKPKPAPTPPNP-KPTPAPTPPKP 108 >At4g12470.1 68417.m01972 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to pEARLI 1 (Accession No. L43080): an Arabidopsis member of a conserved gene family (PGF95-099), Plant Physiol. 109 (4), 1497 (1995); contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 32.3 bits (70), Expect = 0.46 Identities = 13/36 (36%), Positives = 15/36 (41%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P +P P PPP P P P P +P Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSPNPRPVTP 67 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/43 (34%), Positives = 17/43 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P P +P P P P P S P P P PP +P S Sbjct: 32 PSPKPKPVPSPKPKPVQCPPPPRPSVPSP-NPRPVTPPRTPGS 73 >At3g60280.1 68416.m06738 uclacyanin 3 (UCC3) identical to uclacyanin 3 GI:3395770 from [Arabidopsis thaliana]; contains Pfam profile PF02298: Plastocyanin-like domain; identical to cDNA uclacyanin 3 (UCC3)GI:3395769 Length = 222 Score = 32.3 bits (70), Expect = 0.46 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 P P P S P S P SPP P P PPSP SP Sbjct: 123 PSPSTPSSPPSTP-STPSSPPSTPSTPSSPPSPPSPPSP 160 Score = 31.1 bits (67), Expect = 1.1 Identities = 18/54 (33%), Positives = 21/54 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P +P S+P S P +P P P PPSP P S P Sbjct: 123 PSPSTPSSPPSTPSTPSSPPSTPSTPSSPPSP---PSPPSPSLPPSSLPPSASP 173 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/55 (30%), Positives = 21/55 (38%), Gaps = 1/55 (1%) Frame = +2 Query: 746 PXPPXQPX-PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P P +P S+P S P P P P P SP + +L P Sbjct: 132 PSTPSTPSSPPSTPSTPSSPPSPPSPPSPSLPPSSLPPSASPPTNGTPDSETLTP 186 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/46 (41%), Positives = 20/46 (43%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSP 877 P PP P P S P S P S SPP P PPP+P P Sbjct: 152 PSPPSPPSP--SLPPSSLPPS--ASPPTNGTPDSETLTPPPAPLPP 193 >At5g65390.1 68418.m08224 arabinogalactan-protein (AGP7) Length = 130 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAP---XSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P +P P +P S P S P P PP+P P Sbjct: 40 PPPAATPAPTTTPPPAVSPAPTSSPPSSAPSPSSDAPTASPPAPEGP 86 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/48 (33%), Positives = 19/48 (39%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 T P P P P +P P + P SP P P P PS +P Sbjct: 30 TTVTPPPVATPPPAATPAPTTTP-PPAVSPAPTSSPPSSAPSPSSDAP 76 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P P P+ +P P + P + +PPP P PPS Sbjct: 28 PTTTVTPPPVATPPPAATP-APTTTPPPAVSPAPTSSPPS 66 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 1/40 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPX-SAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P+ P P P P P PP P PPP P Sbjct: 223 PP--PVPVYKPPPKVELPPPIPKKPCPPKPPKIEHPPPVP 260 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/44 (29%), Positives = 14/44 (31%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P+ P P P PP P PP P Sbjct: 181 PCPPKYSPPVEVPPPVPVYEPPPKKEIPPPVPVYDPPPKKEVPP 224 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 31.9 bits (69), Expect = 0.60 Identities = 18/43 (41%), Positives = 19/43 (44%), Gaps = 4/43 (9%) Frame = +2 Query: 746 PXPPXQ--PXPLXS--PXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P PP P PL S P P AP + SPPPP PP Sbjct: 42 PPPPQVFVPEPLFSEPPPPPKAPVNVSLSPPPPPRSPSTSTPP 84 >At2g42520.1 68415.m05262 DEAD box RNA helicase, putative similar to SP|O00571 DEAD-box protein 3 (Helicase-like protein 2) {Homo sapiens}, DEAD box RNA helicase DDX3 [Homo sapiens] GI:3523150; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 633 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXG 754 G G GGG G GGGG G G G G G+ G Sbjct: 586 GYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGGYGG 626 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/43 (39%), Positives = 18/43 (41%) Frame = -2 Query: 873 EXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 E G G G GGGG G G G G G G+ GG G Sbjct: 577 EGSFGSGRGGYG--GGGGGYGGGGGYGGGGGYGGGGGYGGGYG 617 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GG G GGGG G G G G G G G Sbjct: 583 GRGGYGGGGGGYGGGGGYGGGGGYGGGGGYGGGYGGASSGG 623 >At1g62760.1 68414.m07083 invertase/pectin methylesterase inhibitor family protein low similarity to extensin [Volvox carteri] GI:21992 Length = 312 Score = 31.9 bits (69), Expect = 0.60 Identities = 19/43 (44%), Positives = 19/43 (44%), Gaps = 2/43 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSX--PXSPPPPXXPXXXXPPPSPXS 874 P P P S P SAP S P SPPP PPP P S Sbjct: 83 PSLSPSP-PSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSS 124 Score = 31.1 bits (67), Expect = 1.1 Identities = 19/54 (35%), Positives = 20/54 (37%), Gaps = 2/54 (3%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPP--XXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P S + P S S PPP P PPP SP SL P Sbjct: 34 PSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSP 87 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/47 (40%), Positives = 20/47 (42%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSPXSP 877 P PP PL S P +P S P S P PP PPP SP Sbjct: 69 PPPPPSSSPLSSLSPSLSP-SPPSSSPSSAPPSSLSPSSPPPLSLSP 114 Score = 29.5 bits (63), Expect = 3.2 Identities = 22/57 (38%), Positives = 22/57 (38%), Gaps = 5/57 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP---PSP--XSPHXXXXXSLLP 907 PP P SP P S S P PPP P P PSP SP SL P Sbjct: 49 PPSSLSP-SSPPPLSLSPSSPPPPPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSP 104 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP P SP P S S P PPP P P S S + Sbjct: 98 PPSSLSP-SSPPPLSLSPSSPPPPPPSSSPLSSLSPSSSSSTY 139 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/53 (35%), Positives = 20/53 (37%), Gaps = 2/53 (3%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSX--PXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P P P S+P S P P P PPS SP SL P Sbjct: 65 PSSPPP---PPPSSSPLSSLSPSLSPSPPSSSPSSAPPSSLSPSSPPPLSLSP 114 >At1g34360.1 68414.m04266 translation initiation factor 3 (IF-3) family protein low similarity to Translation initiation factor IF-3 from [subsp. Schizaphis graminum] {Buchnera aphidicola} SP|P46243, {Salmonella typhimurium} SP|P33321; contains Pfam profiles PF05198: Translation initiation factor IF-3 N-terminal domain, PF00707: Translation initiation factor IF-3 C-terminal domain Length = 520 Score = 31.9 bits (69), Expect = 0.60 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P +P P S P AP P P P P PPP Sbjct: 420 PNQRPSPPQSRFPDQAPNQQPSGPSPNRHPDRQGPPP 456 >At1g27750.1 68414.m03391 ubiquitin system component Cue domain-containing protein very low similarity to ASC-1 complex subunit P100 [Homo sapiens] GI:12061187; contains Pfam profile PF02845: CUE domain Length = 1973 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P + P P + P P S PP P P SP P Sbjct: 869 PPEPPPEMMPPPPQALPPPLPHSHPPLVPPPPFSPLLSPRLP 910 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 31.9 bits (69), Expect = 0.60 Identities = 15/41 (36%), Positives = 16/41 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P P P + P PPP PPP P Sbjct: 241 PTPPPPPPP---PIPVKQSATPPPPPPPKLKNNGPSPPPPP 278 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/42 (35%), Positives = 16/42 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P +PPPP P PSP P Sbjct: 239 PDPTPPP---PPPPPIPVKQSATPPPPPPPKLKNNGPSPPPP 277 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/44 (34%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P S PPPP P P P P Sbjct: 239 PDPTPPPPP---PPPIPVKQSATPPPPPPPKLKNNGPSPPPPPP 279 >At1g12040.1 68414.m01390 leucine-rich repeat family protein / extensin family protein (LRX1) similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 744 Score = 31.9 bits (69), Expect = 0.60 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P PP P S+P P SPPPP P PPP Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPP-CPESSPPPP 541 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P SP P S P +P PP PP +P P Sbjct: 600 PSPVYYPQVTPSPPPPSPLYYPPVTPSPPPPSPVYYPPVTPSPP 643 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P SP P S P +P PP PP +P P Sbjct: 615 PSPLYYPPVTPSPPPPSPVYYPPVTPSPPPPSPVYYPPVTPSPP 658 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P SP + P P SP PP PPP Sbjct: 441 PPPPPYSKMSPSVRAYPPPPPPSPSPPPPYVYSSPPP 477 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P S P S PPP PPP P Sbjct: 458 PPPPPSPSPPPPYVYSSPPPPYVYSSPPPPPYVYSSPPPPP 498 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP-----PPPXXPXXXXPPPSPXSP 877 PP P SP P S P P PPP PPP P P Sbjct: 484 PPPPPYVYSSPPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPP 530 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/38 (36%), Positives = 14/38 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P SP P S P PP P P PP P Sbjct: 504 PPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 PP P P P P P P PPP P P P P SP Sbjct: 621 PPVTPSP-PPPSPVYYPPVTPSPPPPSPVYYPPVTPSPPPPSP 662 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/48 (35%), Positives = 17/48 (35%), Gaps = 6/48 (12%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXS------PPPPXXPXXXXPPPSPXSP 877 PP P SP P S P PPPP P P SP P Sbjct: 494 PPPPPYVYSSPPPPYVYSSPPPPYVYSSPPPPPPSPPPPCPESSPPPP 541 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXP---PPSPXSP 877 P P P P SP P + PPP P P P P SP Sbjct: 526 PPSPPPPCPESSPPPPVVYYAPVTQSPPPPSPVYYPPVTQSPPPPSP 572 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/46 (36%), Positives = 17/46 (36%), Gaps = 2/46 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP--XSPPPPXXPXXXXPPPSPXSP 877 P P P SP P S P SPPPP PSP P Sbjct: 570 PSPVYYPPVTNSPPPPSPVYYPPVTYSPPPPSPVYYPQVTPSPPPP 615 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/44 (31%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P SP P S +P PP PP +P P Sbjct: 585 PSPVYYPPVTYSPPPPSPVYYPQVTPSPPPPSPLYYPPVTPSPP 628 >At5g33390.1 68418.m03985 glycine-rich protein similar to nuclear antigen EBNA-1 (GI:3342234) {Cercopithecine herpesvirus 15} Length = 118 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G G GG G G G G+ RG G GG G Sbjct: 34 GSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDGRGIG-GGGRG 76 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/45 (35%), Positives = 16/45 (35%), Gaps = 1/45 (2%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXG-AXXGXGEXRGXGWXGGXG 745 G G GG GG G G G G G RG G G G Sbjct: 21 GGSGSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRG 65 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G G G GG G G G G G G Sbjct: 24 GSGGSGSGGSGSGGSGSGGRANGRGNGGRGSGRGGGRGDGRGDG 67 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/41 (36%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS--APXSXPXSPPPPXXPXXXXPPPSP 868 PP P + SP P +P P + PP P PPP P Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPP 84 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P S P PPPP PPP P Sbjct: 144 PPPPVLLSPPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRP 184 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS--APXSXPXSPPPPXXPXXXXPPPSP 868 PP P L P P +P P + PP P PPP P Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 102 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 2/41 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS--APXSXPXSPPPPXXPXXXXPPPSP 868 PP P L P P +P P + PP P PPP P Sbjct: 80 PPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPP 120 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPSP 868 P P L SP P S P P PP P PPP P Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPP 129 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS--APXSXPX--SPPPPXXPXXXXPPPSPXSP 877 PP P L P P +P P SPPPP PPP SP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVNLSPPPPPVNLSP 116 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/41 (39%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPSP 868 P P L SP P S P P PP P PPP P Sbjct: 116 PPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPP 156 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/45 (37%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX-SPPPPXXPXXXXPPPSPXSP 877 P PP P P S P SPPPP PPP SP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVNLSPPPPPVLLSP 98 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/46 (39%), Positives = 19/46 (41%), Gaps = 4/46 (8%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS--APXSXPX--SPPPPXXPXXXXPPPSPXSP 877 PP P L P P +P P SPPPP PPP SP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSP 143 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PP P P +A PPPP PPP P Sbjct: 170 PPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPPP 210 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 2/41 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXS--APXSXPXSPPPPXXPXXXXPPPSP 868 PP P L P P +P P PP P PPP P Sbjct: 107 PPPPPVNLSPPPPPVLLSPPPPPVLLSPPPPPVNLSPPPPP 147 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/45 (35%), Positives = 17/45 (37%), Gaps = 4/45 (8%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSP----PPPXXPXXXXPPPSPXSP 877 P P L SP P S P P PPP PPP+ P Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLFSPPPPTVTRP 169 >At5g15780.1 68418.m01845 pollen Ole e 1 allergen and extensin family protein contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 401 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P P P+ P P P S P PPPP P P P Sbjct: 331 PTLPPLPVLPPVPIVNPPSLP--PPPPSFPVPLPPVP 365 Score = 31.1 bits (67), Expect = 1.1 Identities = 21/57 (36%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXP--XXXXPPPSPXSPHXXXXXSLLPL 910 P P P PL P P S P P P PP P PP+P P +L PL Sbjct: 282 PTPTLPPNPLI-PSPPSLP-PIPLIPTPPTLPTIPLLPTPPTPTLPPIPTIPTLPPL 336 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/44 (31%), Positives = 15/44 (34%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P + P P P PP P P PP P P Sbjct: 262 PPNPLNPPSIIPPNPLIPSIPTPTLPPNPLIPSPPSLPPIPLIP 305 >At3g50580.1 68416.m05532 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 265 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP-SPXSPHXXXXXSLLP 907 P P P P P + SPPPP PP +P PH S P Sbjct: 77 PSTPIPSTPSTPSPPPPAPKKSPPPPTPKKSPSPPSLTPFVPHPTPKKSPSP 128 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/46 (36%), Positives = 19/46 (41%), Gaps = 1/46 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPX-PXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P P P P +P P AP P +P P PPP P S H Sbjct: 120 PTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPP-PPSHH 164 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 1/34 (2%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSP 868 P S P + S P +P PPP P PPP+P Sbjct: 71 PAISISPSTPIPSTPSTPSPPPPAPKKSPPPPTP 104 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/41 (36%), Positives = 16/41 (39%), Gaps = 3/41 (7%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPP---PPXXPXXXXPPPSP 868 P P P SP P S P P P P PPP+P Sbjct: 99 PPPPTPKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLPPPAP 139 Score = 28.3 bits (60), Expect = 7.4 Identities = 19/54 (35%), Positives = 21/54 (38%), Gaps = 6/54 (11%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSP------PPPXXPXXXXPPPSPXSP 877 T P PP P P SP P + P P P P P PPP+P P Sbjct: 84 TPSTPSPPP-PAPKKSPPPPT-PKKSPSPPSLTPFVPHPTPKKSPSPPPTPSLP 135 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/52 (32%), Positives = 19/52 (36%), Gaps = 5/52 (9%) Frame = +2 Query: 734 TXXXPXPPXQPXPLXSPXPXSAPXSXPXSP-----PPPXXPXXXXPPPSPXS 874 T P P + P P P P + SP PPP PPPS S Sbjct: 114 TPFVPHPTPKKSPSPPPTPSLPPPAPKKSPSTPSLPPPTPKKSPPPPPSHHS 165 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 PP P P SP S P P PPP P +P PH Sbjct: 135 PP--PAPKKSPSTPSLPPPTPKKSPPPPPSHHSSSPSNP--PH 173 >At3g43583.1 68416.m04636 hypothetical protein Length = 100 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP +P P P P P P P P P PPP Sbjct: 22 PPEKP-PSPEPPPSPEPPPSPEKPTSPEQPSSPEPPP 57 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP P P SP PP P PPPSP P Sbjct: 4 PEPPPHCRGFHCHRSNHRPPEKPPSPEPPPSPE---PPPSPEKP 44 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP 832 P PP P P SP ++P P SP PP Sbjct: 29 PEPPPSPEPPPSPEKPTSP-EQPSSPEPP 56 >At2g45470.1 68415.m05655 fasciclin-like arabinogalactan-protein (FLA8) Length = 420 Score = 31.5 bits (68), Expect = 0.80 Identities = 13/41 (31%), Positives = 17/41 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P+ +P P A P + PP P P +P Sbjct: 338 PSPAPAPEPVTAPTPSPADAPSPTAASPPAPPTDESPESAP 378 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/40 (40%), Positives = 18/40 (45%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P +P P P SA + PPPP P PPP P S Sbjct: 212 PTKPEP---NKPQSAVGANGLPPPPPPPPHQAQPPPPPPS 248 >At2g27380.1 68415.m03302 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 761 Score = 31.5 bits (68), Expect = 0.80 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPPPSP 868 P P P P+ SP P P +P PP P PP+P Sbjct: 338 PPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPPTP 380 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSPXSP 877 PP +P P+ P P +P P PP P PPP P Sbjct: 468 PPIKPPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPP 512 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSPXSP 877 PP +P P+ P P +P P PP P PPP P Sbjct: 334 PPIKPPPVKPPTPIYSPPVKPPPVHKPPTPIYSPPVKPPPVHKPP 378 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 17/43 (39%), Gaps = 2/43 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP--PPPXXPXXXXPPPSP 868 P P P P SP P P +P PP P PP+P Sbjct: 472 PPPVKPPTPTYSPPVQPPPVQKPPTPTYSPPVKPPPIQKPPTP 514 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/45 (33%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSPXSP 877 PP +P P+ P P +P P PP P PPP P Sbjct: 518 PPIKPPPVKPPTPTYSPPIKPPPVHKPPTPTYSPPIKPPPIHKPP 562 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 16/44 (36%), Gaps = 2/44 (4%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXP--XSPPPPXXPXXXXPPPSPXSP 877 PP P P+ P S P P PP P PPP P Sbjct: 65 PPIYPPPIQKPPTYSPPIYPPPIQKPPTPTYSPPIYPPPIQKPP 108 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP +P P+ P + S P PPP P PP P Sbjct: 501 PPVKPPPIQKPPTPT--YSPPIKPPPVKPPTPTYSPPIKPPP 540 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/35 (34%), Positives = 15/35 (42%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P+ SP P P + PP P PP+P Sbjct: 59 PPPIYSPPIYPPPIQKPPTYSPPIYPPPIQKPPTP 93 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP +P P+ P + S P PPP P PP P Sbjct: 317 PPIKPPPVQKPPTPT--YSPPIKPPPVKPPTPIYSPPVKPPP 356 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/42 (33%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP +P P+ P + S P PPP P PP P Sbjct: 451 PPVKPPPVHKPPTPT--YSPPIKPPPVKPPTPTYSPPVQPPP 490 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/47 (36%), Positives = 20/47 (42%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPLXSPX-PXSAPXSXPX---SPPPPXXPXXXXPPP-SPXSP 877 PP QP P+ P P +P P PP P PPP P +P Sbjct: 484 PPVQPPPVQKPPTPTYSPPVKPPPIQKPPTPTYSPPIKPPPVKPPTP 530 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP Q P + P P P P P PP P +P Sbjct: 305 PPVQKPPTPTYSPPIKPPPVQKPPTPTYSPPIKPPPVKPPTP 346 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP Q P + P P P P P PP P +P Sbjct: 389 PPIQKPPTPTYSPPIKPPPLQKPPTPTYSPPIKLPPVKPPTP 430 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/45 (35%), Positives = 18/45 (40%), Gaps = 3/45 (6%) Frame = +2 Query: 752 PPXQPXPLXS-PXPXSAP--XSXPXSPPPPXXPXXXXPPPSPXSP 877 PP +P PL P P +P P PP P PPP P Sbjct: 401 PPIKPPPLQKPPTPTYSPPIKLPPVKPPTPIYSPPVKPPPVHKPP 445 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/44 (31%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P+ P P P + SPP P P P+ SP Sbjct: 697 PPTPTYSPPV-KPPPVQVPPTPTYSPPIKPPPVQVPPTPTTPSP 739 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 31.5 bits (68), Expect = 0.80 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 2/46 (4%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGG-GGEXGXEXGAXXGXG-EXRGXGWXGGXG 745 G G GG G GG GG G G G G RG G GG G Sbjct: 88 GNSGGGGSSGGRGGFGGGGGRGGGRGGGSYGGGYGGRGSGGRGGGG 133 >At2g05440.1 68415.m00574 glycine-rich protein Length = 127 Score = 31.5 bits (68), Expect = 0.80 Identities = 18/44 (40%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G G G G G GG G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGG-GGGYG 104 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G G G G+ GG G Sbjct: 42 GYGGGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGGGGG 80 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGGG G + G G G GG G Sbjct: 51 GGHGGGGGHGHGGHNGGGGH-GLDGYGGGGGHYGGGGGHYGGGG 93 >At1g49270.1 68414.m05524 protein kinase family protein contains Pfam domain PF00069: Protein kinase domain Length = 699 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P S+ SPPP PPP P SP Sbjct: 11 PPAPPPPSPPSPPSSNDQQTTSPPPSDNQETTSPPP-PSSP 50 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P S + SPPPP P P PSP +P Sbjct: 252 PPPGSMGTNWVSSPPPPP-PGNWQPMPSPPAP 282 >At1g31280.1 68414.m03828 PAZ domain-containing protein / piwi domain-containing protein similar to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}, SP|Q9XGW1 PINHEAD protein (ZWILLE protein) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1013 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G G G GGGGE G + G G + RG G G G Sbjct: 13 GRGRGGRGYGGGGGGGEQGRDRG-YGGGEQGRGRGSERGGG 52 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 31.5 bits (68), Expect = 0.80 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P SP P P SPPPP PPP+P Sbjct: 320 PPPPPYVYTSPPP---PPYVYKSPPPPPYVDSYSPPPAP 355 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/42 (38%), Positives = 16/42 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P SP P P PPPP PPP SP Sbjct: 130 PPPPPYVYSSPPPP--PYVYSSPPPPPYVYKSPPPPPYVYSP 169 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 6/45 (13%) Frame = +2 Query: 752 PPXQPXPLXSPXPX----SAPXSXPX--SPPPPXXPXXXXPPPSP 868 PP P SP P +P P SPPPP PPP P Sbjct: 140 PPPPPYVYSSPPPPPYVYKSPPPPPYVYSPPPPPPYVYQSPPPPP 184 >At1g23540.1 68414.m02960 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 720 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSP-XPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P P P S P P P PP PP SP P Sbjct: 134 PPSSPSPNVGPTNPESPPLQSP--PAPPASDPTNSPPASPLDP 174 Score = 31.5 bits (68), Expect = 0.80 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P P P P+ P ++P + P +PP P PP +P S Sbjct: 171 PLDPTNPPPIQPSGPATSPPANPNAPP---SPFPTVPPKTPSS 210 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS---APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P SP P S P SPPPP PP +P Sbjct: 66 PLPSILPPLTDSPPPPSDSSPPVDSTPSPPPPTSNESPSPPEDSETP 112 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +2 Query: 752 PPXQPXPLX-SPXPXSAPXSXPXSP--PPPXXPXXXX--PPPSPXSP 877 PP Q P + P ++P + P P PPP P PP +P +P Sbjct: 150 PPLQSPPAPPASDPTNSPPASPLDPTNPPPIQPSGPATSPPANPNAP 196 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/39 (43%), Positives = 18/39 (46%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG GGGGE G G+ G G RG G G G Sbjct: 442 GGGAPLTMIGGGGGEQGVT-GSDGGGGRGRGGGKVAGGG 479 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G+GGG G GGGG G + G G+ GG G Sbjct: 403 GGGGDGGGGQGTGIGGGGG--GEQGTGVGGGGDTCTQVTHGGGG 444 >At1g04800.1 68414.m00476 glycine-rich protein Length = 200 Score = 31.5 bits (68), Expect = 0.80 Identities = 17/42 (40%), Positives = 20/42 (47%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G+ G GGG G G GG G G+ G G G G+ GG Sbjct: 54 GDLGGGGGISGGGGFGAGG--GWIGGSVGGFGGGIGGGFGGG 93 >At4g37450.1 68417.m05301 arabinogalactan-protein (AGP18) identical to gi_11935088_gb_AAG41964 Length = 209 Score = 31.1 bits (67), Expect = 1.1 Identities = 15/42 (35%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP P P SP + S P S PP P PP +P Sbjct: 81 PPPTPVPESSPPVPAPMVSSPVSSPPVPAPVADSPPAPVAAP 122 >At4g28300.2 68417.m04053 hydroxyproline-rich glycoprotein family protein Length = 438 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP Q +P P S P S + PP PPP+P P Sbjct: 183 PPPPTQLQNTPAPVPVSTPPSQLQA--PPAQSQFMPPPPAPSHP 224 >At4g28300.1 68417.m04052 hydroxyproline-rich glycoprotein family protein Length = 496 Score = 31.1 bits (67), Expect = 1.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP Q +P P S P S + PP PPP+P P Sbjct: 241 PPPPTQLQNTPAPVPVSTPPSQLQA--PPAQSQFMPPPPAPSHP 282 >At5g57070.1 68418.m07124 hydroxyproline-rich glycoprotein family protein Common family members: At5g26070, At5g19800, At1g72790 [Arabidopsis thaliana] Length = 575 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +2 Query: 788 PXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P S P P +PPPP P P P H Sbjct: 241 PSSPPQQPPATPPPPPPPPPVEVPQKPRRTH 271 Score = 25.8 bits (54), Expect(2) = 1.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +2 Query: 812 PXSPPPPXXPXXXXPPPSP 868 P SPPPP P PPP P Sbjct: 297 PPSPPPPPPP----PPPQP 311 Score = 23.4 bits (48), Expect(2) = 1.3 Identities = 9/24 (37%), Positives = 9/24 (37%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP 823 PP QP P P P P P Sbjct: 244 PPQQPPATPPPPPPPPPVEVPQKP 267 >At5g67470.1 68418.m08507 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 899 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/44 (29%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP + +P P PPP PPP P +P Sbjct: 347 PPPPPNRAAFQAITQEKSPVPPPRRSPPPLQTPPPPPPPPPLAP 390 Score = 30.7 bits (66), Expect = 1.4 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P +P PPPP P PPP P Sbjct: 367 PPPRRSPPPLQTPPPPPPPPPLAPPPPPQKRP 398 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP 832 P P P PL +P P P P +PPPP Sbjct: 367 PPPRRSPPPLQTPPPPPPPP--PLAPPPP 393 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/33 (51%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 779 SPXPXSAPXSXPXSPPPPXXP-XXXXPPPSPXS 874 SP S P P SPPPP P PPPSP S Sbjct: 44 SPVQSSPP---PPSPPPPSTPTTACPPPPSPPS 73 >At5g14540.1 68418.m01704 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 547 Score = 30.7 bits (66), Expect = 1.4 Identities = 15/44 (34%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P QP P P P + P PPP PPP P Sbjct: 306 PPPTIQP-PYQPPPPTQSLHQPPYQPPPQQPQYPQQPPPQLQHP 348 >At2g43150.1 68415.m05358 proline-rich extensin-like family protein similar to CRANTZ hydroxyproline-rich glycoprotein [Manihot esculenta] gi|7211797|gb|AAF40442; similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 212 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/47 (38%), Positives = 21/47 (44%), Gaps = 7/47 (14%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPPPS 865 P PP P P+ SP P S+P SPPPP PPP+ Sbjct: 164 PPPPYYYHSPPPPVKSPPPPYLYSSPPPPVKSPPPPVYIYASPPPPT 210 Score = 29.9 bits (64), Expect = 2.4 Identities = 20/53 (37%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP P P+ SP P S+P SPPPP PP SP P+ Sbjct: 68 PPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 120 Score = 29.5 bits (63), Expect = 3.2 Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP + P P+ SP P +P SPPPP PP SP P+ Sbjct: 36 PPPPYEYKSPPPPVKSPPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 88 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP + P P+ SP P +P SPPPP PP SP P+ Sbjct: 52 PPPPYEYKSPPPPVKSPPPPYYYHSPPPPVKSPPPPYVYSSPPPPVKSPPPPY 104 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPX----QPXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP P P+ SP P +P SPPPP PP SP P+ Sbjct: 84 PPPPYVYSSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 136 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP P P+ SP P +P SPPPP PP SP P+ Sbjct: 100 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 152 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP P P+ SP P +P SPPPP PP SP P+ Sbjct: 116 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 168 Score = 27.9 bits (59), Expect = 9.8 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 8/53 (15%) Frame = +2 Query: 746 PXPPXQ----PXPLXSPXP---XSAPXSXPXSPPPPXXPXXXXPP-PSPXSPH 880 P PP P P+ SP P +P SPPPP PP SP P+ Sbjct: 132 PPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPYYYHSPPPPVKSPPPPY 184 >At2g42010.1 68415.m05197 phospholipase D beta 1 / PLD beta 1 (PLDBETA1) identical to SP|P93733 Phospholipase D beta 1 (EC 3.1.4.4) (AtPLDbeta1) (PLD beta 1) (PLDbeta) {Arabidopsis thaliana}; contains Pfam profiles: PF00614 phospholipase D.active site motif, PF00168 C2 domain Length = 1083 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/48 (37%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 746 PXPPXQ-PXPLXSPXPXSAPXSXPXSPPPP---XXPXXXXPPPSPXSP 877 P P Q P P P P P S P PPP P PPP +P Sbjct: 9 PYPYGQYPYPYPYPAPYRPPSSEPYPPPPTNQYSAPYYPYPPPPYATP 56 Score = 29.5 bits (63), Expect = 3.2 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 2/47 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP--SPXSPH 880 P P P P P + S P P PP P PPP SP PH Sbjct: 22 PAPYRPPSSEPYPPPPTNQYSAPYYPYPP--PPYATPPPYASPPPPH 66 >At2g05440.2 68415.m00575 glycine-rich protein Length = 154 Score = 30.7 bits (66), Expect = 1.4 Identities = 18/47 (38%), Positives = 19/47 (40%), Gaps = 3/47 (6%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXG---WXGGXG 745 G GGG G GGGG G G G G G G + GG G Sbjct: 62 GGHNGGGGHGLDGYGGGGGHYGGGGGHYGGGGGHYGGGGGHYGGGGG 108 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG G GGGG G G G G G+ GG G Sbjct: 42 GYGGGHGGHGGHGGGG--GHGHGGHNGGGGHGLDGYGGGGG 80 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/44 (38%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG G GGGG G + G G G GG G Sbjct: 51 GGHGGGGGHGHGGHNGGGGH-GLDGYGGGGGHYGGGGGHYGGGG 93 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/39 (41%), Positives = 16/39 (41%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG G GGG G G G G G G GG G Sbjct: 104 GGGGGHYGGGGGGHGGGGHYGG-GGGGYGGGGGHHGGGG 141 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP P S P SP PP P PPSP P Sbjct: 38 PPTQPG--GPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYP 77 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 30.7 bits (66), Expect = 1.4 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP QP P S P SP PP P PPSP P Sbjct: 38 PPTQPG--GPPAWYSNQFHHPHSPSPPPPPPPQWGPPSPHYP 77 >At1g63550.1 68414.m07184 hypothetical protein low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 299 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP--XXPXXXXPPPS 865 P P P P P S P S P +P PP P P PS Sbjct: 227 PPSPSAPPPRSPPPKSSPPSSLPQTPSPPLVFTPPQNVPNPS 268 >At5g58540.1 68418.m07330 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 484 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 P PP + SP P P +PP P P PSP P Sbjct: 86 PPPPPEGNETPSPPRSGVPTQTPETPPAITPLPVPLAPAPSPSPP 130 >At5g53870.1 68418.m06701 plastocyanin-like domain-containing protein contains similarity to SP|Q02917 Early nodulin 55-2 precursor {Glycine max}; PF02298: Plastocyanin-like domain Length = 370 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P QP SP AP S P PP PP SP Sbjct: 147 PTQPPKSHSPVSPVAPASAPSKSQPPRSSVSPAQPPKSSSP 187 >At5g26070.1 68418.m03102 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; similar to root nodule extensin [Pisum sativum] gi|15021750|gb|AAK77902; Common family members: At5g19800, At5g57070, At1g72790 [Arabidopsis thaliana] Length = 102 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +2 Query: 761 QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 QP SP P +P + P PP P PP+ PH Sbjct: 37 QPLYSPSPSPYRSPVTLPPPPPHPAYSRPVALPPTLPIPH 76 >At5g19800.1 68418.m02353 hydroxyproline-rich glycoprotein family protein similar to extensin [Catharanthus roseus] gi|1486263|dbj|BAA13175; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 96 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/41 (34%), Positives = 15/41 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P +A PPPP PPP P Sbjct: 46 PISPPPPPPPPPPQSHAAAYKRYSPPPPPSKYGRVYPPPPP 86 >At4g34440.1 68417.m04894 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 670 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P S+P S PPP PPP+P Sbjct: 33 PTPPSSPPPSSISAPPPDISASFSPPPAP 61 Score = 29.5 bits (63), Expect = 3.2 Identities = 21/55 (38%), Positives = 25/55 (45%), Gaps = 11/55 (20%) Frame = +2 Query: 746 PXPPXQPXP--LXSPXP-XSAPXSXPXSPP-----PPXXPXXXXP---PPSPXSP 877 P PP P P + +P P SA S P +PP PP P P PSP +P Sbjct: 33 PTPPSSPPPSSISAPPPDISASFSPPPAPPTQETSPPTSPSSSPPVVANPSPQTP 87 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 2/40 (5%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPP-PPXXPXXXXPP-PSPXSP 877 P +P P + S P +PP PP P P P+P SP Sbjct: 84 PQTPENPSPPAPEGSTPVTPPAPPQTPSNQSPERPTPPSP 123 >At4g29030.1 68417.m04151 glycine-rich protein glycine-rich protein - Onobrychis viciifolia,PID:g2565429 Length = 115 Score = 30.3 bits (65), Expect = 1.8 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G G GG G G G G G G G G Sbjct: 58 GVSGPGGNLGYGGFGGAGGGLGGGLGGGAGSGLGGGLGGGSGIG 101 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 30.3 bits (65), Expect = 1.8 Identities = 19/40 (47%), Positives = 19/40 (47%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P QP P SP P P S P SPPPP PPP S Sbjct: 40 PCQPNP--SPPP---PPSNP-SPPPPSPTTTACPPPPSSS 73 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/41 (36%), Positives = 17/41 (41%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P+ SP P P P P P PPP+P P Sbjct: 55 PPPPTPVYSPPPADLPPP----PTPYYSPPADLPPPTPIYP 91 Score = 29.1 bits (62), Expect = 4.3 Identities = 18/49 (36%), Positives = 20/49 (40%), Gaps = 3/49 (6%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPP---PSPXSPHXXXXXSLLP 907 P SP P S S P PPP P PP P P +P+ L P Sbjct: 38 PQHSPLP-SPVYSSPADLPPPPTPVYSPPPADLPPPPTPYYSPPADLPP 85 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 1/45 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXS-APXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P+ P P + SPPPP PP P P Sbjct: 85 PPTPIYPPPVAFPPPQAYQAYYYRKSPPPPPSKYGKVYPPPPAKP 129 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 3/42 (7%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP---XXPXXXXPPP 862 P P P P P P + S P PPP P PPP Sbjct: 58 PTPVYSPPPADLPPPPTPYYSPPADLPPPTPIYPPPVAFPPP 99 >At3g07540.1 68416.m00900 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 841 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +2 Query: 788 PXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P SPPPP P PPP+P Sbjct: 48 PPFFPLYSSTSPPPPPSPPQPLPPPAP 74 >At3g05920.1 68416.m00668 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 126 Score = 30.3 bits (65), Expect = 1.8 Identities = 11/26 (42%), Positives = 12/26 (46%) Frame = +2 Query: 800 PXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P PP P P PPP+P P Sbjct: 72 PPPKPPEPPKPPEPEKPKPPPAPEPP 97 >At3g05470.1 68416.m00599 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 884 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/44 (31%), Positives = 18/44 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P + P +P + P +PP P P P P P Sbjct: 96 PWPAPSPSPFPNGGPIESP-AYPPAPPRPIPPHLRRPLPQRTHP 138 >At5g15870.1 68418.m01857 glycosyl hydrolase family 81 protein similar to beta-glucan-elicitor receptor GI:1752734 from [Glycine max] Length = 745 Score = 29.9 bits (64), Expect = 2.4 Identities = 13/27 (48%), Positives = 14/27 (51%), Gaps = 1/27 (3%) Frame = +2 Query: 788 PXSAPXSXPXSPPPP-XXPXXXXPPPS 865 P P + P SPPPP P PPPS Sbjct: 16 PFKKPKNRPPSPPPPLPLPPSPSPPPS 42 >At4g09030.1 68417.m01490 arabinogalactan-protein (AGP10) identical to gi|10880497|gb|AAG24278; supported by Ceres cDNA 265772 Length = 127 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/44 (36%), Positives = 19/44 (43%), Gaps = 1/44 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSPXS 874 P P P P +P P + P + P SPP P PP P S Sbjct: 45 PTPSITPTP--TPTPSATPTAAPVSPPAGSPLPSSASPPAPPTS 86 >At3g51290.1 68416.m05614 proline-rich family protein Length = 602 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/43 (34%), Positives = 18/43 (41%), Gaps = 3/43 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSP---PPPXXPXXXXPPPS 865 P PP P P SP + + + PPP P PPPS Sbjct: 76 PPPPRPPPPPLSPGSETTTWTTTTTSSVLPPPPPPPPPPPPPS 118 >At3g50180.1 68416.m05486 hypothetical protein Length = 588 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 P PP P L + P P PPPP P PPP Sbjct: 8 PPPPPLPPRLELRRQRAPPPQPPPPPPPPPPP----PPP 42 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP Q P+ P P P +PPPP PPP Sbjct: 241 PPPQRPPMGGPPPP--PHIGGSAPPPPHMGGSAPPPP 275 >At3g07100.1 68416.m00845 protein transport protein Sec24, putative similar to protein transport protein Sec24A (SEC24-related protein) [Homo sapiens] SWISS-PROT:O95486 Length = 1038 Score = 29.9 bits (64), Expect = 2.4 Identities = 21/59 (35%), Positives = 22/59 (37%), Gaps = 5/59 (8%) Frame = +2 Query: 746 PXPPXQ---PXPLXSPXPXSAPXSXPXSPPPP--XXPXXXXPPPSPXSPHXXXXXSLLP 907 P PP P P P P AP SPP P P PPP + H SL P Sbjct: 89 PPPPSSNSFPSPAYGP-PGGAPFQRFPSPPFPTTQNPPQGPPPPQTLAGHLSPPMSLRP 146 >At1g76040.2 68414.m08829 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase GB:AAC25423 GI:3283996 [Nicotiana tabacum] Length = 534 Score = 29.9 bits (64), Expect = 2.4 Identities = 15/41 (36%), Positives = 15/41 (36%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 PP PL P S P S P P PPPS S Sbjct: 26 PPHHYQPLPKPTVSQGQTSNPTSNPQPKPKPAPPPPPSTSS 66 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 29.9 bits (64), Expect = 2.4 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 3/48 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSPXSPH 880 P PP + SP P S P SPPPP PP P H Sbjct: 365 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKEKYVYKSPPPPPVHH 412 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 57 PPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 100 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 85 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 128 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 113 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 156 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 141 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 184 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 169 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 212 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 197 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 240 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 225 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 268 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 253 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 296 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 281 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 324 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 309 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 352 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 3/44 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXP---XSPPPPXXPXXXXPPPSP 868 P PP + SP P S P SPPPP PP P Sbjct: 337 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPP 380 >At5g61660.1 68418.m07736 glycine-rich protein Length = 134 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G G G GGGG G G G G G G GG Sbjct: 80 GSGSGTGYGYGSGGGGARGGGYGYGSGNGRSGGGGGGGG 118 >At5g04290.1 68418.m00422 KOW domain-containing transcription factor family protein Length = 1493 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/44 (36%), Positives = 18/44 (40%), Gaps = 2/44 (4%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGE--XGXEXGAXXGXGEXRGXGWXGG 751 G+ +GGG G G GG G G GE RG G G Sbjct: 1303 GKQNDGGGGSSWGKQGDGGSKPWNEHSGGGRGFGERRGGGGFRG 1346 >At4g23882.1 68417.m03434 heavy-metal-associated domain-containing protein Length = 284 Score = 29.5 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXP-LXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 PP Q P +P P P P PPPP P SP Sbjct: 227 PPPQAVPGFTTPIPYPPPSFFPGRPPPPYTGAGMFQSAPPQSP 269 >At3g25500.1 68416.m03171 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 1051 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = +2 Query: 794 SAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 S P S P PP P P PPS P+ L P Sbjct: 35 SPPPSPPSPPPLPKLPFSSTTPPSSSDPNASPFFPLYP 72 >At2g28440.1 68415.m03455 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; + Length = 268 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/50 (34%), Positives = 18/50 (36%), Gaps = 6/50 (12%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSA------PXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP SP P S+ P S SP P PPP P P Sbjct: 104 PQPPSSSPEADSPLPPSSSPEANSPQSPASSPKPESLADSPSPPPPPPQP 153 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P SP P S S P PPPP P P P Sbjct: 131 PASSPKPESLADS-PSPPPPPPQPESPSSPSYP 162 >At2g23130.2 68415.m02759 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 162 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P + + P AP P SP P P P PSP Sbjct: 51 PTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPSP 89 >At2g23130.1 68415.m02760 arabinogalactan-protein (AGP17) identical to gi_11935086_gb_AAG41963 Length = 185 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/39 (33%), Positives = 15/39 (38%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P + + P AP P SP P P P PSP Sbjct: 51 PTPESTEAPAKTPVEAPVEAPPSPTPASTPQISPPAPSP 89 >At2g05530.1 68415.m00585 glycine-rich protein Length = 115 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/44 (38%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GG G GGGG G G G G G G G G Sbjct: 44 GHGGNGGYNGGGGYNGGGGHNG---GGYNGGGGYNGGGHGGRHG 84 >At1g70990.1 68414.m08190 proline-rich family protein Length = 176 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/43 (39%), Positives = 17/43 (39%), Gaps = 5/43 (11%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXP-----XXXXPPPS 865 P Q P SP P S P PPPP P PPPS Sbjct: 86 PCLQNIPPPSPPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPS 128 Score = 29.1 bits (62), Expect = 4.3 Identities = 16/47 (34%), Positives = 17/47 (36%), Gaps = 3/47 (6%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPX---SPPPPXXPXXXXPPPSPXSP 877 P PP P P + P P S P PPPP PP P Sbjct: 96 PPPPSPPPPSQACPPPPLPPSPPKKSYCPPPPSTYIYMTGPPGELYP 142 Score = 28.7 bits (61), Expect = 5.6 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 779 SPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 +P + P P P PP PPP P SP Sbjct: 85 TPCLQNIPPPSPPPPSPPPPSQACPPPPLPPSP 117 >At1g63570.1 68414.m07186 receptor-like protein kinase-related contains Pfam profile: PF01657 Domain of unknown function DUF26; similar to receptor-like protein kinase 4 (GI:13506745) [Arabidopsis thaliana] Length = 284 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/36 (38%), Positives = 15/36 (41%) Frame = +2 Query: 770 PLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P +P P S P P S PP P PP S P Sbjct: 245 PSPAPSPSSLPPISPTSSPPLSLPPQLPPPLSQPPP 280 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXS 874 P P S P +P S P PP P PP P S Sbjct: 247 PAPSPSSLPPISPTSSPPLSLPPQLPPPLSQPPPPLS 283 >At1g62240.1 68414.m07021 expressed protein Length = 227 Score = 29.5 bits (63), Expect = 3.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = -2 Query: 864 EGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 EGGG G GGGG G G G G G GG G Sbjct: 190 EGGGGGGGGGGGGGG------GGVDGSGSGSGSGSGGGSG 223 Score = 29.5 bits (63), Expect = 3.2 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRG 769 G GGG G GGGG G G+ G G G Sbjct: 191 GGGGGGGGGGGGGGGGVDGSGSGSGSGSGGGSG 223 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 GGG G GGGG G G G G G G Sbjct: 96 GGGGGGGGGGGGGGSGGSNGSFFNGSGSGTGYGSGDG 132 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 GGG GGGG+ G+ G G G G G Sbjct: 146 GGGSGEGSGGGGGGDGSSGSGSGSGSGSGSGTGTASG 182 >At1g48410.2 68414.m05409 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1050 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 873 EXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRG 769 E GEG G G GGG G G G+ +G Sbjct: 12 EGGEGSGSREAGPVSGGGRGSQRGGFQQGGGQHQG 46 >At1g48410.1 68414.m05408 argonaute protein (AGO1) identical to SP|O04379 Argonaute protein (AGO1) {Arabidopsis thaliana}; contains Pfam profiles PF02171: Piwi domain, PF02170: PAZ domain Length = 1048 Score = 29.5 bits (63), Expect = 3.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -2 Query: 873 EXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRG 769 E GEG G G GGG G G G+ +G Sbjct: 12 EGGEGSGSREAGPVSGGGRGSQRGGFQQGGGQHQG 46 >At5g62210.1 68418.m07811 embryo-specific protein-related contains weak similarity to embryo-specific protein 3 (GI:3335171) [Arabidopsis thaliana] Length = 223 Score = 29.1 bits (62), Expect = 4.3 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP-PPXXPXXXXPPPSPXS 874 PP P SP P S P PP PP P PPPSP S Sbjct: 159 PPSPDFPPFSPS--IPPPSPPYFPPEPPSIPPP--PPPSPPS 196 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 2/38 (5%) Frame = +2 Query: 770 PLXSPX-PXSAPXSXPXSPPP-PXXPXXXXPPPSPXSP 877 P SP P +P P SPP P P PPP P P Sbjct: 158 PPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSPP 195 Score = 27.9 bits (59), Expect = 9.8 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 3/38 (7%) Frame = +2 Query: 773 LXSPXPXSAPXSXPXSPP-PPXXP--XXXXPPPSPXSP 877 L P P P S PP PP P PPP P SP Sbjct: 157 LPPPSPDFPPFSPSIPPPSPPYFPPEPPSIPPPPPPSP 194 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G GGG G GGG G G G G G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G GGG G GGG G G G G G GG Sbjct: 86 GSGGGGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGG 124 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGG-GEXGXEXGAXXGXGEXRGXGW 760 G G GGG G GGG E G G G G GW Sbjct: 130 GGYGSGGGGGGRGYGGGGRREGGGYGGGDGGSYGGGGGGW 169 Score = 28.3 bits (60), Expect = 7.4 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 4/48 (8%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXG----EXRGXGWXGGXG 745 G G GG GGGG G G G G E R G+ G G Sbjct: 90 GGGGRGGSGGGYRSGGGGGYSGGGGGGYSGGGGGGYERRSGGYGSGGG 137 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 29.1 bits (62), Expect = 4.3 Identities = 11/27 (40%), Positives = 12/27 (44%) Frame = +2 Query: 788 PXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P + P PPPP P PPP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPP 694 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/38 (34%), Positives = 13/38 (34%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P PL P P PPPP PPP P Sbjct: 668 PSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPP 705 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P PL AP PP P P P +P S+ P Sbjct: 250 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPSPRSVSP 303 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/54 (27%), Positives = 17/54 (31%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P PL AP PP P P P +P S+ P Sbjct: 249 PTTPRPPSPLADAPRLDAPRPTTPKPPSPRSDPPRLDAPRPTTPKPPSPRSVSP 302 >At2g42840.2 68415.m05305 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P S PPP P PP P Sbjct: 114 PSTPSHPSTPSHPTPSHPPSGGYYSSPPPRTPVVVTPPSPIVDP 157 >At2g42840.1 68415.m05304 protodermal factor 1 (PDF1) identical to protodermal factor 1 [Arabidopsis thaliana] gi|4929130|gb|AAD33869 Length = 306 Score = 29.1 bits (62), Expect = 4.3 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P P P S PPP P PP P Sbjct: 114 PSTPSHPSTPSHPTPSHPPSGGYYSSPPPRTPVVVTPPSPIVDP 157 >At1g34210.1 68414.m04245 somatic embryogenesis receptor-like kinase 2 (SERK2) nearly identical to somatic embryogenesis receptor-like kinase 2 [Arabidopsis thaliana] GI:14573457; contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain; identical to cDNA somatic embryogenesis receptor-like kinase 2 (SERK2) GI:14573456 Length = 628 Score = 29.1 bits (62), Expect = 4.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +2 Query: 800 PXSXPXSPPPPXXPXXXXPPPSPXS 874 P S P SPPPP P P P S Sbjct: 214 PGSPPFSPPPPFIPPPIVPTPGGYS 238 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 29.1 bits (62), Expect = 4.3 Identities = 17/39 (43%), Positives = 17/39 (43%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P SP P P SPPPP PPPSP Sbjct: 330 PPPPPYVYNSPPP---PPYVYKSPPPPPY-VYSSPPPSP 364 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 PP P SP P +P PPPP PPP Sbjct: 350 PPPPPYVYSSPPP--SPYVYKSPPPPPYVYSSPPPPP 384 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGW 760 G G GGG G GGGG G + G G R W Sbjct: 51 GGYGGGGGRGNRGG-GGGGYQGGDRGGRGSGGGGRDGDW 88 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G+ GGG G G GG G+ G G G G G G Sbjct: 20 GDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXG-XGEXRGXGWXGGXG 745 GG G GGGG G G G G RG GG G Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGW 760 G G GGG G GGGG G + G G R W Sbjct: 51 GGYGGGGGRGNRGG-GGGGYQGGDRGGRGSGGGGRDGDW 88 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G+ GGG G G GG G+ G G G G G G Sbjct: 20 GDGYGGGGGYGGGDAGYGGRGASGGGSYGGRGGYGGGGGRGNRG 63 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/40 (40%), Positives = 16/40 (40%), Gaps = 1/40 (2%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXG-XGEXRGXGWXGGXG 745 GG G GGGG G G G G RG GG G Sbjct: 44 GGSYGGRGGYGGGGGRGNRGGGGGGYQGGDRGGRGSGGGG 83 >At5g55750.1 68418.m06949 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 175 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 2/42 (4%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXS--PPPPXXPXXXXPPPSPXS 874 P P P SP P + S P S PP P PP P S Sbjct: 65 PPPPSPQYSPPPPPSQSSPPRSRCPPVPTTGCCNQPPGPPPS 106 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/39 (41%), Positives = 17/39 (43%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG G GGGG G G G G G + GG G Sbjct: 371 GGGGYDMGGVGGGGAGGYGAG---GGGNGGGSFYGGGGG 406 Score = 28.7 bits (61), Expect = 5.6 Identities = 17/41 (41%), Positives = 18/41 (43%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG GGGG G G+ G G RG GG G Sbjct: 379 GVGGGGAGGYGAGGGGNGG---GSFYGGGGGRGGYGGGGSG 416 >At4g11430.1 68417.m01841 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; related to hydroxyproline-rich glycoprotein [Phaseolus vulgaris] gi|169349|gb|AAA33765 Length = 219 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P S + SPPPP P PPP P Sbjct: 97 PPPPPPPPLSAITTTGHHHHRRSPPPPPPP----PPPPP 131 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/45 (33%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAP-------XSXPXSPPPPXXPXXXXPP 859 P PP P P +P + S P PPPP P PP Sbjct: 123 PPPPPPPPPTITPPVTTTTAGHHHHRRSPPPPPPPPPPPPTITPP 167 >At3g62680.1 68416.m07041 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 313 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/39 (35%), Positives = 16/39 (41%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P+ P P + P PPP P P PSP Sbjct: 116 PPVYTPPVYKPTPV---YTKPTIPPPVYTPPVYKPTPSP 151 >At3g60900.1 68416.m06813 fasciclin-like arabinogalactan-protein (FLA10) Length = 422 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/42 (30%), Positives = 15/42 (35%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P+ +P P A P P P PP SP Sbjct: 339 PAPAPEPVSAPTPTPAKSPSPVEAPSPTAASPPAPPVDESSP 380 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPP 832 P P P SP P AP SPP P Sbjct: 345 PVSAPTPTPAKSPSPVEAPSPTAASPPAP 373 >At3g55950.1 68416.m06217 protein kinase family protein contains protein kinase domain, Pfam:PF00069; similar to cytokinin-regulated kinase 1 [Nicotiana tabacum] gi|10998537|gb|AAG25966 Length = 814 Score = 28.7 bits (61), Expect = 5.6 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +2 Query: 788 PXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P S P P PPPP P P PS SP Sbjct: 361 PASPPSQFPLPPPPPPPP----PSPSTSSP 386 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 2/27 (7%) Frame = +2 Query: 794 SAPXSXPXSPPP--PXXPXXXXPPPSP 868 S P P SPP P P PPPSP Sbjct: 355 SCPIQFPASPPSQFPLPPPPPPPPPSP 381 >At3g53330.1 68416.m05884 plastocyanin-like domain-containing protein similar to mavicyanin SP:P80728 from [Cucurbita pepo] Length = 310 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/54 (29%), Positives = 20/54 (37%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPHXXXXXSLLP 907 P P P P + P S P +PPPP P P +P +LP Sbjct: 135 PITPSPPPPSKTHEP-----SRPNTPPPPPPPSKTHEPSRRITPSPPPPSKILP 183 >At3g32400.1 68416.m04142 formin homology 2 domain-containing protein / FH2 domain-containing protein common family members: At2g43800, At3g25500, At5g48360, At4g15200, At3g05470, At3g07540, At5g07780, At5g07650 [Arabidopsis thaliana]; Length = 488 Score = 28.7 bits (61), Expect = 5.6 Identities = 19/46 (41%), Positives = 19/46 (41%), Gaps = 3/46 (6%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPP-PPXX--PXXXXPPPSPXSPH 880 PP P PL P SA S P PP PP PPP P H Sbjct: 13 PPPPPPPLLQPH-HSALSSSPLPPPLPPKKLLATTNTPPPPPPPLH 57 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 28.7 bits (61), Expect = 5.6 Identities = 16/44 (36%), Positives = 16/44 (36%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P PP S S P P SP PP PPP SP Sbjct: 17 PSPPSNTNSTTS----SPPAPSPPSPTPPQGDSSSSPPPDSTSP 56 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPS 865 P PP Q SP P S P +P PP PPS Sbjct: 38 PTPP-QGDSSSSPPPDSTSPPAPQAPNPPNSSNNSPSPPS 76 >At1g72600.1 68414.m08395 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 135 Score = 28.7 bits (61), Expect = 5.6 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +2 Query: 821 PPPPXXPXXXXPPPSP 868 PPPP P PPPSP Sbjct: 40 PPPPPPPLSLSPPPSP 55 >At1g67770.1 68414.m07733 RNA-binding protein, putative similar to terminal ear1 gb|AAC39463.1 Length = 527 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPP 859 P PP P P P S S P PPPP P P Sbjct: 42 PHPPPPPPPPPPPLYFSY-FSLPPPPPPPHLPPTSVTP 78 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +2 Query: 770 PLXSPX-PXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P SP P P S P PPPP P P SP+ Sbjct: 12 PWNSPYSPHLHPPSAPLPPPPPLPPPPPPRQSHPESPN 49 >At5g43770.1 68418.m05353 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 187 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P PL P P SP PP PP+P +P Sbjct: 112 PSDPPPLGPPQTPGPEFPVPPSPSPPMPDTPN--PPTPKTP 150 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 17/44 (38%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSP 877 P P P P +P SPPPP PPP P SP Sbjct: 229 PAPYVYSSPPPPPYYSPSPKVNYKSPPPPY--VYSSPPPPPYSP 270 >At4g08380.1 68417.m01384 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 437 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/42 (38%), Positives = 17/42 (40%), Gaps = 3/42 (7%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPP---PXXPXXXXPPPSP 868 PP P SP +P SPPP P PPPSP Sbjct: 179 PPYAYSPPPSPYVYKSPPYVYSSPPPYAYSPPPYAYSPPPSP 220 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 28.3 bits (60), Expect = 7.4 Identities = 13/45 (28%), Positives = 16/45 (35%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP + P P PPP PPP+P P+ Sbjct: 69 PPPPSSSGGVKYPPPYGGDGYGGYYPPPYYGNYGTPPPPNPIVPY 113 >At2g38910.1 68415.m04783 calcium-dependent protein kinase, putative / CDPK, putative similar to calcium-dependent protein kinase, isoform AK1 (CDPK) [Arabidopsis thaliana] SWISS-PROT:Q06850; contains protein kinase domain, Pfam:PF00069; contains EF hand domain (calcium-binding EF-hand), Pfam:PF00036, INTERPRO:IPR002048 Length = 583 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/29 (41%), Positives = 14/29 (48%) Frame = +2 Query: 782 PXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P + P P +PPPP PPP P Sbjct: 64 PAPSTLPT--PSTPPPPVKMANEEPPPKP 90 >At2g34670.1 68415.m04259 proline-rich family protein contains proline-rich region, INTERPRO:IPR000694 Length = 561 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +2 Query: 773 LXSPXPXSAPXSXPXSPPPP 832 L P P S P + P SPPPP Sbjct: 70 LSLPLPPSPPPTLPPSPPPP 89 >At2g05510.1 68415.m00583 glycine-rich protein Length = 127 Score = 28.3 bits (60), Expect = 7.4 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG G G GG G G G G + GG G Sbjct: 52 GGGHYGGGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGG 90 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/39 (38%), Positives = 15/39 (38%) Frame = -2 Query: 861 GGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 GGG G GGGG G G G G GG G Sbjct: 58 GGGHGHGGHNGGGGHGLDGYGGGHGGHYGGGGGHYGGGG 96 >At2g05380.1 68415.m00566 glycine-rich protein (GRP3S) identical to cDNA glycine-rich protein 3 short isoform (GRP3S) GI:4206766 Length = 116 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/44 (36%), Positives = 18/44 (40%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G+ GG G G GG G G G G +G G G G Sbjct: 42 GGFGDNGGGRYQGGGGHGGHGG--GGYQGGGGRYQGGGGRQGGG 83 >At1g62250.2 68414.m07023 expressed protein Length = 223 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +2 Query: 104 VCLRPRRCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 229 +C +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPTVIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g62250.1 68414.m07022 expressed protein Length = 267 Score = 28.3 bits (60), Expect = 7.4 Identities = 10/42 (23%), Positives = 21/42 (50%) Frame = +2 Query: 104 VCLRPRRCVRWLLTPHLHQELMTYWRSSCI*VSSLVNTRPLS 229 +C +RW TP + E+++ WR C +++ R ++ Sbjct: 181 LCTPQPTVIRWSSTPSVSDEILSKWRGFCAVIANAYYIRGMA 222 >At1g33240.1 68414.m04108 trihelix DNA-binding protein, putative similar to GTL1 [Arabidopsis thaliana] GI:2664198 Length = 669 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/49 (32%), Positives = 17/49 (34%), Gaps = 4/49 (8%) Frame = +2 Query: 746 PXPPXQPXPLXSPX----PXSAPXSXPXSPPPPXXPXXXXPPPSPXSPH 880 P PP QP P + P S S P PPP P PH Sbjct: 357 PPPPYQPPPAVTKRVAEPPLSTAQSQSQQPIMAIPQQQILPPPPPSHPH 405 >At1g30970.1 68414.m03792 zinc finger (C2H2 type) family protein contains Pfam domain PF00096: Zinc finger, C2H2 type Length = 367 Score = 28.3 bits (60), Expect = 7.4 Identities = 15/43 (34%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSP-PPPXXPXXXXPPPSPXSP 877 P QP P+ P P S P P P P P PS P Sbjct: 204 PAIQPSPVTGVTPPGIPTSSPAMPVPQPLFPVVNNSIPSQAPP 246 >At5g25590.1 68418.m03045 expressed protein contains Pfam profile PF04783: Protein of unknown function (DUF630) Length = 775 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 1/23 (4%) Frame = +2 Query: 812 PXSP-PPPXXPXXXXPPPSPXSP 877 P SP PPP P PPP P P Sbjct: 85 PASPQPPPPPPIENLPPPPPPLP 107 >At5g21280.1 68418.m02555 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 302 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +2 Query: 812 PXSPPPPXXPXXXXPPPSPXSP 877 P PPPP P PP P P Sbjct: 99 PPQPPPPPQPLNLFSPPPPPPP 120 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/44 (34%), Positives = 17/44 (38%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G GGG GGGG+ G + G G G G G Sbjct: 324 GGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGPNG 367 >At5g19080.1 68418.m02268 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 378 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 4/45 (8%) Frame = +2 Query: 752 PPXQPXPLXS-PXPXSAPXSXPX---SPPPPXXPXXXXPPPSPXS 874 PP QP P + P S P PPP P PPPS S Sbjct: 31 PPQQPPPQNGYSYSHNYPVSTPQLSLPPPPAQPPSSSQPPPSQIS 75 >At5g07540.1 68418.m00863 glycine-rich protein (GRP16) oleosin; glycine-rich protein 16 (GRP16) PMID:11431566 Length = 244 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/39 (35%), Positives = 14/39 (35%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGG 751 G GG G GGG G GA G G GG Sbjct: 136 GASGGGDKPGGASGGGPGGASGGASGGASGGASGGASGG 174 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/41 (41%), Positives = 17/41 (41%) Frame = -2 Query: 867 GEGGGXXXXGXXGGGGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G GGG GGGG G G G G G G GG G Sbjct: 122 GGGGGY-----SGGGGGYGGGGGGYGGGGGGYGGGGDGGGG 157 >At3g28820.1 68416.m03596 expressed protein ; expression supported by MPSS Length = 434 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 200 TLIYSCSASTSSVLGASVALEASAHTGEDEGKQSQS 93 T++ S + S SS +SV EAS+ + GK+S+S Sbjct: 183 TMVSSTTNSASSNEESSVGKEASSENSKSSGKESES 218 >At3g28810.1 68416.m03595 hypothetical protein Length = 434 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = -3 Query: 200 TLIYSCSASTSSVLGASVALEASAHTGEDEGKQSQS 93 T++ S + S SS +SV EAS+ + GK+S+S Sbjct: 183 TMVSSTTNSASSNEESSVGKEASSENSKSSGKESES 218 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +2 Query: 761 QPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPP 862 QP P +P P S S P SP P P P Sbjct: 32 QPTPSTNPSPSSVVSSIPSSPAPQSPSLNPNPNP 65 >At3g06140.1 68416.m00705 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 Zinc finger, C3HC4 type (RING finger) Length = 359 Score = 27.9 bits (59), Expect = 9.8 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +2 Query: 821 PPPPXXPXXXXPPPSPXSPH 880 PPPP PPP P PH Sbjct: 25 PPPPYYYLDPPPPPPPFPPH 44 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 1/42 (2%) Frame = +2 Query: 746 PXPPXQPXPLXSPXPXSAPXSXPXSPPP-PXXPXXXXPPPSP 868 P PP Q P S P PPP P PPP P Sbjct: 258 PPPPPQVYQTQPPSWPSQPQQHSMVPPPMQFRPPQGMPPPPP 299 >At1g70250.1 68414.m08082 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 799 Score = 27.9 bits (59), Expect = 9.8 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +2 Query: 752 PPXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 PP P P P SP PP P P P P Sbjct: 101 PPPPPDLFPPPSAQMLPPPPASSPAPPSPPSSSRPRPLP 139 >At1g63600.1 68414.m07189 protein kinase-related low similarity to receptor-like protein kinase 5 [Arabidopsis thaliana] GI:13506747; contains Pfam profile: PF01657 Domain of unknown function DUF26 Length = 302 Score = 27.9 bits (59), Expect = 9.8 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +2 Query: 764 PXPLXSPXPXSAPXSXPXSPPPP 832 P P SP P S+P P P PP Sbjct: 257 PPPYPSPPPPSSPLFSPLLPSPP 279 >At1g31310.1 68414.m03831 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965; Length = 383 Score = 27.9 bits (59), Expect = 9.8 Identities = 15/38 (39%), Positives = 15/38 (39%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P QP P P P S P P PPP P P P Sbjct: 219 PLQPPP---PPPPSQPLPRPLLLPPPPPPSFHAQPILP 253 >At1g07135.1 68414.m00759 glycine-rich protein Length = 155 Score = 27.9 bits (59), Expect = 9.8 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 1/41 (2%) Frame = -2 Query: 864 EGGGXXXXGXXGGGGEXGXEX-GAXXGXGEXRGXGWXGGXG 745 +GGG G GGG G G G R W G G Sbjct: 64 KGGGGGGGGRGGGGARSGGRSRGGGGGSSSSRSRDWKRGGG 104 >At1g04930.1 68414.m00490 hydroxyproline-rich glycoprotein family protein Common family member: At2g32840 [Arabidopsis thaliana] Length = 332 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/38 (31%), Positives = 14/38 (36%) Frame = +2 Query: 755 PXQPXPLXSPXPXSAPXSXPXSPPPPXXPXXXXPPPSP 868 P P P P P + P PPP P P+P Sbjct: 25 PVTPVNTVRPPPSQPPPAPPPLPPPTYRPIAPLRHPNP 62 >At1g04660.1 68414.m00463 glycine-rich protein Length = 212 Score = 27.9 bits (59), Expect = 9.8 Identities = 17/45 (37%), Positives = 18/45 (40%), Gaps = 1/45 (2%) Frame = -2 Query: 876 GEXGEGGGXXXXGXXGG-GGEXGXEXGAXXGXGEXRGXGWXGGXG 745 G G+ GG G GG GG G G G G G GG G Sbjct: 158 GGIGKAGGIGGLGGLGGAGGGLGGVGGLGKAGGIGVGGGIGGGHG 202 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,519,548 Number of Sequences: 28952 Number of extensions: 233265 Number of successful extensions: 6909 Number of sequences better than 10.0: 204 Number of HSP's better than 10.0 without gapping: 1080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4404 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -