BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M23 (891 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 1e-06 SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 1e-06 SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) 36 2e-06 SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 6e-06 SB_6624| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 9e-06 SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) 36 1e-05 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 36 1e-05 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 1e-05 SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 1e-05 SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 35 2e-05 SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) 35 2e-05 SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) 35 2e-05 SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) 35 2e-05 SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) 35 2e-05 SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) 35 2e-05 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 35 2e-05 SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) 35 2e-05 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) 35 2e-05 SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) 35 2e-05 SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) 35 2e-05 SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) 35 2e-05 SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) 35 2e-05 SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) 35 2e-05 SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) 35 2e-05 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 35 2e-05 SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) 35 2e-05 SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) 35 2e-05 SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 35 2e-05 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 35 2e-05 SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) 35 2e-05 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 35 2e-05 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 35 2e-05 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 35 2e-05 SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) 35 2e-05 SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) 35 2e-05 SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) 35 2e-05 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 35 2e-05 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 35 2e-05 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) 35 2e-05 SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) 35 2e-05 SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) 35 2e-05 SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) 35 2e-05 SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 35 2e-05 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 35 2e-05 SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) 35 2e-05 SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) 35 2e-05 SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) 35 2e-05 SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) 35 2e-05 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 35 2e-05 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) 35 2e-05 SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 35 2e-05 SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) 35 2e-05 SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) 35 2e-05 SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) 35 2e-05 SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) 35 2e-05 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) 35 2e-05 SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) 35 2e-05 SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) 35 2e-05 SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) 35 2e-05 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) 35 2e-05 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 35 2e-05 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) 35 2e-05 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 35 2e-05 SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) 35 2e-05 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 35 2e-05 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) 35 2e-05 SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 35 2e-05 SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 35 2e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 35 2e-05 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) 35 2e-05 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) 35 2e-05 SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) 35 2e-05 SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 35 2e-05 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 35 2e-05 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 35 2e-05 SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 35 2e-05 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 35 2e-05 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) 35 2e-05 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 35 2e-05 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 35 2e-05 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 35 2e-05 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) 35 2e-05 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 35 2e-05 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) 35 2e-05 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 35 2e-05 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) 35 2e-05 SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) 35 2e-05 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 35 2e-05 SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 35 2e-05 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) 35 2e-05 SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) 35 2e-05 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 35 2e-05 SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) 35 2e-05 SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) 35 2e-05 SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 35 2e-05 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) 35 2e-05 SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) 35 2e-05 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 35 2e-05 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 35 2e-05 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 35 2e-05 SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) 35 2e-05 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_42151| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38896| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29254| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24446| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_19194| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18659| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_2451| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_58128| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53698| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52557| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_48482| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_42028| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40596| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39544| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35695| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35230| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35048| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34691| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34125| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32443| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29380| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23079| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_22871| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18801| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18037| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_17135| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16602| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16324| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_15175| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_15145| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_14442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10623| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8423| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8316| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_7697| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_7274| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_5755| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23906| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_51213| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_41957| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57920| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55096| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_50037| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_48519| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39248| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34127| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_26811| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24858| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_8427| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59622| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59470| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59436| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59341| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_59321| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_58497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_58355| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_58133| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57986| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57590| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57358| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_57221| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_56778| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_56683| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_56485| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55971| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55894| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55772| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55573| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55103| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_55047| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_54903| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_54851| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_54482| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53836| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53493| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_53207| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52948| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52761| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52662| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_52572| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_51972| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_51882| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_51647| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_51566| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_50537| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_50288| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_49986| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_49737| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_49720| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_48785| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_47297| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_46711| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_46514| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_46282| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_46221| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45973| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45744| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45621| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_45037| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44899| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44593| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44213| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44147| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44009| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_43277| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_43007| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_42249| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_42173| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_41969| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40919| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40898| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40785| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40759| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40215| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_40094| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39735| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39642| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39320| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_39131| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38904| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38654| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_38140| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37833| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37700| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37634| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37586| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37467| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37442| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37275| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_37081| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36845| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36843| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36822| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36551| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36480| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_36092| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35911| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35809| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35616| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_35217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34399| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_34227| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_33490| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_33281| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32291| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32217| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32188| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_32050| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_31071| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30889| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30453| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30166| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_30004| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29620| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29583| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29433| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_29146| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_28829| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_28797| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_28439| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_28002| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_27895| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_26278| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_26029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_25252| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_25111| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24900| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24899| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24625| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24558| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24302| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_24239| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23976| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23972| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23930| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23315| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_23224| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_22743| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_22298| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21944| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21220| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21197| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_21163| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_20993| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_20955| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_20043| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_19497| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_19432| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_19022| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18824| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18805| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_18337| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_17968| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_17922| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16840| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16512| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_15715| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_15545| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_14983| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_14379| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_14356| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_14291| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_13233| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12576| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12547| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12526| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_12145| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_11105| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10967| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10941| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10936| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10912| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10853| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_10650| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9879| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9713| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9545| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9371| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9155| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_9004| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_7935| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_7176| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_6789| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_6469| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_5965| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_5643| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_5028| Best HMM Match : Fels1 (HMM E-Value=8.3) 35 2e-05 SB_4630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3927| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3332| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_3073| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_2981| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_2447| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_2382| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_1765| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_1674| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_1464| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_551| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_260| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_16696| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 2e-05 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 35 2e-05 >SB_36015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 35.9 bits (79), Expect(2) = 1e-06 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 6/46 (13%) Frame = +2 Query: 512 KQVNNNNCIHFMFQVQGEVWEGF------SALMNRPTXGXKRVAYW 631 + ++ N C+ F GE++ +ALMNRPT G +R AYW Sbjct: 102 EDIDGNYCLQFYLHKSGEIYWLVGKPVVPAALMNRPTRGERRFAYW 147 Score = 34.7 bits (76), Expect(2) = 1e-06 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 182 RICDTGYIPLPRSLTRYARSFDCGE 206 >SB_39345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 38.7 bits (86), Expect(2) = 1e-06 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGEXVSAHSKAG 718 R+ G +P+PRSLT ARSF CGE A+ + G Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGERKMAYERGG 109 Score = 31.9 bits (69), Expect(2) = 1e-06 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_46352| Best HMM Match : L71 (HMM E-Value=0.19) Length = 179 Score = 35.5 bits (78), Expect(2) = 2e-06 Identities = 22/60 (36%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Frame = +2 Query: 458 FVKFXDAIALFVTIISCNKQVN--NNNCIHFMFQVQGEVWEGFSALMNRPTXGXKRVAYW 631 F K+ + F +I++ + N N C +M V V +ALMNRPT G +R AYW Sbjct: 41 FCKWLLGVFEFCSILAPEIETNFSTNRCRRYMATVGKPVVP--AALMNRPTRGERRFAYW 98 Score = 34.7 bits (76), Expect(2) = 2e-06 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 133 RICDTGYIPLPRSLTRYARSFDCGE 157 >SB_37260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 818 Score = 36.3 bits (80), Expect(2) = 6e-06 Identities = 21/53 (39%), Positives = 27/53 (50%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGEXVSAHSKAGIRLSPXIRGITXXKKTCDP 775 R+ G +P+PRSLT ARSF CGE + A I R +T K +P Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGERKWLTNGAEISWKMPGRYLTGNPKRTEP 128 Score = 31.9 bits (69), Expect(2) = 6e-06 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_6624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.9 bits (79), Expect(2) = 9e-06 Identities = 16/25 (64%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +PVPRSLT ARSF CGE Sbjct: 59 RICDTGYIPVPRSLTRYARSFDCGE 83 Score = 31.9 bits (69), Expect(2) = 9e-06 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_47784| Best HMM Match : Ank (HMM E-Value=1.4e-08) Length = 593 Score = 35.5 bits (78), Expect(2) = 1e-05 Identities = 21/50 (42%), Positives = 26/50 (52%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGEXVSAHSKAGIRLSPXIRGITXXKKT 766 R+ G +P+PRSLT ARSF CGE + A I R +T K T Sbjct: 131 RICDTGYIPLPRSLTRYARSFDCGERKWLTNGAEISWKMPGRYLTGKKPT 180 Score = 31.9 bits (69), Expect(2) = 1e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 35.5 bits (78), Expect(2) = 1e-05 Identities = 20/51 (39%), Positives = 26/51 (50%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGEXVSAHSKAGIRLSPXIRGITXXKKTC 769 R+ G +P+PRSLT ARSF CGE + A I R +T + C Sbjct: 178 RICDTGYIPLPRSLTRYARSFDCGERKWLTNGAEISWKMPGRYLTGKLRNC 228 Score = 31.9 bits (69), Expect(2) = 1e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 127 AALMNRPTRGERRFAYW 143 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 34.7 bits (76), Expect(2) = 1e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 120 RICDTGYIPLPRSLTRYARSFDCGE 144 Score = 32.7 bits (71), Expect(2) = 1e-05 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 5/44 (11%) Frame = +2 Query: 515 QVNNNNCIHFMFQVQ---GEVWEGF--SALMNRPTXGXKRVAYW 631 +++NNN I + V G V + +ALMNRPT G +R AYW Sbjct: 42 ELDNNNTIKLIDTVDLEGGPVGKPVVPAALMNRPTRGERRFAYW 85 >SB_33209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 35.1 bits (77), Expect(2) = 1e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 59 RICDTGYIPLPRSLTRYARSFNCGE 83 Score = 31.9 bits (69), Expect(2) = 1e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_23046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2708 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 2662 RICDTGYIPLPRSLTRYARSFDCGE 2686 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 2611 AALMNRPTRGERRFAYW 2627 >SB_6916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2670 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 1475 RICDTGYIPLPRSLTRYARSFDCGE 1499 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 1424 AALMNRPTRGERRFAYW 1440 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 599 RICDTGYIPLPRSLTRYARSFDCGE 623 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 548 AALMNRPTRGERRFAYW 564 >SB_5128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2102 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 537 RICDTGYIPLPRSLTRYARSFDCGE 561 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 486 AALMNRPTRGERRFAYW 502 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 994 RICDTGYIPLPRSLTRYARSFDCGE 1018 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 943 AALMNRPTRGERRFAYW 959 >SB_19464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_45953| Best HMM Match : LRR_1 (HMM E-Value=7.4e-15) Length = 1427 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 1381 RICDTGYIPLPRSLTRYARSFDCGE 1405 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 1330 AALMNRPTRGERRFAYW 1346 >SB_9532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 1205 RICDTGYIPLPRSLTRYARSFDCGE 1229 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 1154 AALMNRPTRGERRFAYW 1170 >SB_9823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1329 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 1072 RICDTGYIPLPRSLTRYARSFDCGE 1096 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 1021 AALMNRPTRGERRFAYW 1037 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 94 RICDTGYIPLPRSLTRYARSFDCGE 118 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 43 AALMNRPTRGERRFAYW 59 >SB_52560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1263 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 445 RICDTGYIPLPRSLTRYARSFDCGE 469 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 394 AALMNRPTRGERRFAYW 410 >SB_3169| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1096 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 1050 RICDTGYIPLPRSLTRYARSFDCGE 1074 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 999 AALMNRPTRGERRFAYW 1015 >SB_30603| Best HMM Match : PKD_channel (HMM E-Value=1.2e-15) Length = 1029 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 983 RICDTGYIPLPRSLTRYARSFDCGE 1007 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 932 AALMNRPTRGERRFAYW 948 >SB_22715| Best HMM Match : SAM_PNT (HMM E-Value=1.8) Length = 996 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_50269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 940 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 610 RICDTGYIPLPRSLTRYARSFDCGE 634 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 559 AALMNRPTRGERRFAYW 575 >SB_47507| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_32555| Best HMM Match : RVT_1 (HMM E-Value=2e-35) Length = 895 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 853 RICDTGYIPLPRSLTRYARSFDCGE 877 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 802 AALMNRPTRGERRFAYW 818 >SB_38368| Best HMM Match : zf-C3HC4 (HMM E-Value=4.4e-15) Length = 846 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) Length = 841 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 349 RICDTGYIPLPRSLTRYARSFDCGE 373 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 298 AALMNRPTRGERRFAYW 314 >SB_9528| Best HMM Match : 7tm_1 (HMM E-Value=2.6e-39) Length = 841 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 795 RICDTGYIPLPRSLTRYARSFDCGE 819 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 744 AALMNRPTRGERRFAYW 760 >SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 833 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 392 RICDTGYIPLPRSLTRYARSFDCGE 416 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 341 AALMNRPTRGERRFAYW 357 >SB_19841| Best HMM Match : Myb_DNA-binding (HMM E-Value=1.1) Length = 753 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 273 RICDTGYIPLPRSLTRYARSFDCGE 297 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 222 AALMNRPTRGERRFAYW 238 >SB_29430| Best HMM Match : AhpC-TSA (HMM E-Value=0.00012) Length = 704 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 488 RICDTGYIPLPRSLTRYARSFDCGE 512 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 437 AALMNRPTRGERRFAYW 453 >SB_54325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 636 RICDTGYIPLPRSLTRYARSFDCGE 660 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 585 AALMNRPTRGERRFAYW 601 >SB_26697| Best HMM Match : EGF (HMM E-Value=7.5e-34) Length = 684 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 168 RICDTGYIPLPRSLTRYARSFDCGE 192 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 117 AALMNRPTRGERRFAYW 133 >SB_45253| Best HMM Match : ig (HMM E-Value=0.00016) Length = 678 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 195 RICDTGYIPLPRSLTRYARSFDCGE 219 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 144 AALMNRPTRGERRFAYW 160 >SB_34032| Best HMM Match : 7tm_1 (HMM E-Value=1.3e-22) Length = 673 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 627 RICDTGYIPLPRSLTRYARSFDCGE 651 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 576 AALMNRPTRGERRFAYW 592 >SB_6150| Best HMM Match : GAT (HMM E-Value=2.3e-34) Length = 674 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 628 RICDTGYIPLPRSLTRYARSFDCGE 652 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 577 AALMNRPTRGERRFAYW 593 >SB_5006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 657 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 409 RICDTGYIPLPRSLTRYARSFDCGE 433 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 358 AALMNRPTRGERRFAYW 374 >SB_53615| Best HMM Match : GETHR (HMM E-Value=5.3e-09) Length = 653 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 250 RICDTGYIPLPRSLTRYARSFDCGE 274 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 199 AALMNRPTRGERRFAYW 215 >SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) Length = 634 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 495 RICDTGYIPLPRSLTRYARSFDCGE 519 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 444 AALMNRPTRGERRFAYW 460 >SB_13248| Best HMM Match : SCP (HMM E-Value=2.6e-21) Length = 631 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 520 RICDTGYIPLPRSLTRYARSFDCGE 544 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 469 AALMNRPTRGERRFAYW 485 >SB_602| Best HMM Match : TSP_1 (HMM E-Value=1e-27) Length = 590 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 544 RICDTGYIPLPRSLTRYARSFDCGE 568 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 493 AALMNRPTRGERRFAYW 509 >SB_31774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 584 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 538 RICDTGYIPLPRSLTRYARSFDCGE 562 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 487 AALMNRPTRGERRFAYW 503 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 522 RICDTGYIPLPRSLTRYARSFDCGE 546 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) Length = 568 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 522 RICDTGYIPLPRSLTRYARSFDCGE 546 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 471 AALMNRPTRGERRFAYW 487 >SB_38317| Best HMM Match : bZIP_2 (HMM E-Value=5.1e-14) Length = 561 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 515 RICDTGYIPLPRSLTRYARSFDCGE 539 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 464 AALMNRPTRGERRFAYW 480 >SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) Length = 558 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 512 RICDTGYIPLPRSLTRYARSFDCGE 536 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 461 AALMNRPTRGERRFAYW 477 >SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) Length = 556 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 352 RICDTGYIPLPRSLTRYARSFDCGE 376 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 301 AALMNRPTRGERRFAYW 317 >SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) Length = 520 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 474 RICDTGYIPLPRSLTRYARSFDCGE 498 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 423 AALMNRPTRGERRFAYW 439 >SB_215| Best HMM Match : ALG3 (HMM E-Value=0.18) Length = 521 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 439 RICDTGYIPLPRSLTRYARSFDCGE 463 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 388 AALMNRPTRGERRFAYW 404 >SB_8444| Best HMM Match : BRE (HMM E-Value=6.4) Length = 502 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 59 RICDTGYIPLPRSLTRYARSFDCGE 83 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_49291| Best HMM Match : Herpes_UL69 (HMM E-Value=4.5) Length = 491 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 366 RICDTGYIPLPRSLTRYARSFDCGE 390 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 315 AALMNRPTRGERRFAYW 331 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 442 RICDTGYIPLPRSLTRYARSFDCGE 466 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 391 AALMNRPTRGERRFAYW 407 >SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) Length = 473 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 79 RICDTGYIPLPRSLTRYARSFDCGE 103 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 28 AALMNRPTRGERRFAYW 44 >SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 422 RICDTGYIPLPRSLTRYARSFDCGE 446 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 371 AALMNRPTRGERRFAYW 387 >SB_55215| Best HMM Match : Peptidase_A16_N (HMM E-Value=0.0003) Length = 458 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 59 RICDTGYIPLPRSLTRYARSFDCGE 83 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_26979| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=0.017) Length = 453 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 284 RICDTGYIPLPRSLTRYARSFDCGE 308 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_15857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 452 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 196 RICDTGYIPLPRSLTRYARSFDCGE 220 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 145 AALMNRPTRGERRFAYW 161 >SB_31098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 436 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_1434| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 416 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 370 RICDTGYIPLPRSLTRYARSFDCGE 394 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 319 AALMNRPTRGERRFAYW 335 >SB_27641| Best HMM Match : Ank (HMM E-Value=8.6e-05) Length = 397 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 351 RICDTGYIPLPRSLTRYARSFDCGE 375 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 300 AALMNRPTRGERRFAYW 316 >SB_40752| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.5) Length = 374 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 328 RICDTGYIPLPRSLTRYARSFDCGE 352 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 277 AALMNRPTRGERRFAYW 293 >SB_5443| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 371 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 325 RICDTGYIPLPRSLTRYARSFDCGE 349 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 274 AALMNRPTRGERRFAYW 290 >SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 370 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 324 RICDTGYIPLPRSLTRYARSFDCGE 348 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 273 AALMNRPTRGERRFAYW 289 >SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) Length = 370 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 324 RICDTGYIPLPRSLTRYARSFDCGE 348 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 273 AALMNRPTRGERRFAYW 289 >SB_39083| Best HMM Match : PhaC_N (HMM E-Value=0.7) Length = 369 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 323 RICDTGYIPLPRSLTRYARSFDCGE 347 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 272 AALMNRPTRGERRFAYW 288 >SB_32162| Best HMM Match : Ras (HMM E-Value=4.7e-31) Length = 357 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 203 RICDTGYIPLPRSLTRYARSFDCGE 227 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 152 AALMNRPTRGERRFAYW 168 >SB_42061| Best HMM Match : CcoS (HMM E-Value=1.5) Length = 346 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_4813| Best HMM Match : EMP24_GP25L (HMM E-Value=3.9e-13) Length = 348 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 295 RICDTGYIPLPRSLTRYARSFDCGE 319 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 244 AALMNRPTRGERRFAYW 260 >SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 334 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_11146| Best HMM Match : K_tetra (HMM E-Value=1.1e-34) Length = 336 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 290 RICDTGYIPLPRSLTRYARSFDCGE 314 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 239 AALMNRPTRGERRFAYW 255 >SB_16101| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 336 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_870| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-09) Length = 334 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 288 RICDTGYIPLPRSLTRYARSFDCGE 312 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 237 AALMNRPTRGERRFAYW 253 >SB_37689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 284 RICDTGYIPLPRSLTRYARSFDCGE 308 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 233 AALMNRPTRGERRFAYW 249 >SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 324 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 278 RICDTGYIPLPRSLTRYARSFDCGE 302 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 227 AALMNRPTRGERRFAYW 243 >SB_34374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 260 RICDTGYIPLPRSLTRYARSFDCGE 284 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 209 AALMNRPTRGERRFAYW 225 >SB_10695| Best HMM Match : Pollen_Ole_e_I (HMM E-Value=5.2) Length = 300 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 254 RICDTGYIPLPRSLTRYARSFDCGE 278 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 203 AALMNRPTRGERRFAYW 219 >SB_50666| Best HMM Match : ig (HMM E-Value=2.8e-20) Length = 293 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 247 RICDTGYIPLPRSLTRYARSFDCGE 271 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 196 AALMNRPTRGERRFAYW 212 >SB_33205| Best HMM Match : Mucin (HMM E-Value=0.0024) Length = 286 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 240 RICDTGYIPLPRSLTRYARSFDCGE 264 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 189 AALMNRPTRGERRFAYW 205 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 241 RICDTGYIPLPRSLTRYARSFDCGE 265 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 190 AALMNRPTRGERRFAYW 206 >SB_17258| Best HMM Match : DUF791 (HMM E-Value=0.002) Length = 288 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 242 RICDTGYIPLPRSLTRYARSFDCGE 266 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 191 AALMNRPTRGERRFAYW 207 >SB_32080| Best HMM Match : Plasmid_stabil (HMM E-Value=5.7) Length = 284 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 238 RICDTGYIPLPRSLTRYARSFDCGE 262 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 187 AALMNRPTRGERRFAYW 203 >SB_34207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 282 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 236 RICDTGYIPLPRSLTRYARSFDCGE 260 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 185 AALMNRPTRGERRFAYW 201 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 226 RICDTGYIPLPRSLTRYARSFDCGE 250 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 175 AALMNRPTRGERRFAYW 191 >SB_10590| Best HMM Match : DUF485 (HMM E-Value=7.3) Length = 270 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 224 RICDTGYIPLPRSLTRYARSFDCGE 248 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 173 AALMNRPTRGERRFAYW 189 >SB_48746| Best HMM Match : fn3 (HMM E-Value=7.2) Length = 255 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 209 RICDTGYIPLPRSLTRYARSFDCGE 233 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 158 AALMNRPTRGERRFAYW 174 >SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 239 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 193 RICDTGYIPLPRSLTRYARSFDCGE 217 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 142 AALMNRPTRGERRFAYW 158 >SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 192 RICDTGYIPLPRSLTRYARSFDCGE 216 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 141 AALMNRPTRGERRFAYW 157 >SB_25779| Best HMM Match : DUF485 (HMM E-Value=5.1) Length = 236 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 130 RICDTGYIPLPRSLTRYARSFDCGE 154 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 79 AALMNRPTRGERRFAYW 95 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 185 RICDTGYIPLPRSLTRYARSFDCGE 209 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 134 AALMNRPTRGERRFAYW 150 >SB_3135| Best HMM Match : KorB_C (HMM E-Value=2.8) Length = 227 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 181 RICDTGYIPLPRSLTRYARSFDCGE 205 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 130 AALMNRPTRGERRFAYW 146 >SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) Length = 217 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 171 RICDTGYIPLPRSLTRYARSFDCGE 195 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 120 AALMNRPTRGERRFAYW 136 >SB_5310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 173 RICDTGYIPLPRSLTRYARSFDCGE 197 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 122 AALMNRPTRGERRFAYW 138 >SB_40524| Best HMM Match : Ribosomal_S18 (HMM E-Value=2) Length = 216 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 170 RICDTGYIPLPRSLTRYARSFDCGE 194 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 170 RICDTGYIPLPRSLTRYARSFDCGE 194 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 119 AALMNRPTRGERRFAYW 135 >SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 169 RICDTGYIPLPRSLTRYARSFDCGE 193 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 118 AALMNRPTRGERRFAYW 134 >SB_3953| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 168 RICDTGYIPLPRSLTRYARSFDCGE 192 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 117 AALMNRPTRGERRFAYW 133 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 167 RICDTGYIPLPRSLTRYARSFDCGE 191 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 165 RICDTGYIPLPRSLTRYARSFDCGE 189 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 114 AALMNRPTRGERRFAYW 130 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 167 RICDTGYIPLPRSLTRYARSFDCGE 191 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 116 AALMNRPTRGERRFAYW 132 >SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 166 RICDTGYIPLPRSLTRYARSFDCGE 190 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 115 AALMNRPTRGERRFAYW 131 >SB_3996| Best HMM Match : Connexin (HMM E-Value=2.4) Length = 205 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 159 RICDTGYIPLPRSLTRYARSFDCGE 183 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_43222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 161 RICDTGYIPLPRSLTRYARSFDCGE 185 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 110 AALMNRPTRGERRFAYW 126 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 159 RICDTGYIPLPRSLTRYARSFDCGE 183 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_9530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 159 RICDTGYIPLPRSLTRYARSFDCGE 183 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 108 AALMNRPTRGERRFAYW 124 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 156 RICDTGYIPLPRSLTRYARSFDCGE 180 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 105 AALMNRPTRGERRFAYW 121 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 158 RICDTGYIPLPRSLTRYARSFDCGE 182 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 107 AALMNRPTRGERRFAYW 123 >SB_6296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 157 RICDTGYIPLPRSLTRYARSFDCGE 181 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 106 AALMNRPTRGERRFAYW 122 >SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) Length = 200 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 154 RICDTGYIPLPRSLTRYARSFDCGE 178 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 103 AALMNRPTRGERRFAYW 119 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 153 RICDTGYIPLPRSLTRYARSFDCGE 177 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_41303| Best HMM Match : DUF485 (HMM E-Value=2) Length = 199 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 153 RICDTGYIPLPRSLTRYARSFDCGE 177 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 102 AALMNRPTRGERRFAYW 118 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 152 RICDTGYIPLPRSLTRYARSFDCGE 176 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 151 RICDTGYIPLPRSLTRYARSFDCGE 175 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_21952| Best HMM Match : Pertussis_S2S3 (HMM E-Value=3.2) Length = 198 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 152 RICDTGYIPLPRSLTRYARSFDCGE 176 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 101 AALMNRPTRGERRFAYW 117 >SB_11820| Best HMM Match : EGF_2 (HMM E-Value=9.8) Length = 197 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 151 RICDTGYIPLPRSLTRYARSFDCGE 175 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_51064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 151 RICDTGYIPLPRSLTRYARSFDCGE 175 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 151 RICDTGYIPLPRSLTRYARSFDCGE 175 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 100 AALMNRPTRGERRFAYW 116 >SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 147 RICDTGYIPLPRSLTRYARSFDCGE 171 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 96 AALMNRPTRGERRFAYW 112 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 149 RICDTGYIPLPRSLTRYARSFDCGE 173 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 98 AALMNRPTRGERRFAYW 114 >SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 149 RICDTGYIPLPRSLTRYARSFDCGE 173 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 98 AALMNRPTRGERRFAYW 114 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 145 RICDTGYIPLPRSLTRYARSFDCGE 169 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 144 RICDTGYIPLPRSLTRYARSFDCGE 168 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 93 AALMNRPTRGERRFAYW 109 >SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 145 RICDTGYIPLPRSLTRYARSFDCGE 169 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) Length = 191 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 145 RICDTGYIPLPRSLTRYARSFDCGE 169 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 94 AALMNRPTRGERRFAYW 110 >SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 141 RICDTGYIPLPRSLTRYARSFDCGE 165 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_12755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 142 RICDTGYIPLPRSLTRYARSFDCGE 166 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 91 AALMNRPTRGERRFAYW 107 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 143 RICDTGYIPLPRSLTRYARSFDCGE 167 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_3664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 143 RICDTGYIPLPRSLTRYARSFDCGE 167 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 92 AALMNRPTRGERRFAYW 108 >SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 141 RICDTGYIPLPRSLTRYARSFDCGE 165 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 90 AALMNRPTRGERRFAYW 106 >SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) Length = 184 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 138 RICDTGYIPLPRSLTRYARSFDCGE 162 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 87 AALMNRPTRGERRFAYW 103 >SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) Length = 186 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 140 RICDTGYIPLPRSLTRYARSFDCGE 164 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 89 AALMNRPTRGERRFAYW 105 >SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 136 RICDTGYIPLPRSLTRYARSFDCGE 160 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 85 AALMNRPTRGERRFAYW 101 >SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 137 RICDTGYIPLPRSLTRYARSFDCGE 161 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 86 AALMNRPTRGERRFAYW 102 >SB_33488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 59 RICDTGYIPLPRSLTRYARSFDCGE 83 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_57210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 133 RICDTGYIPLPRSLTRYARSFDCGE 157 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_53915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 132 RICDTGYIPLPRSLTRYARSFDCGE 156 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 133 RICDTGYIPLPRSLTRYARSFDCGE 157 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 82 AALMNRPTRGERRFAYW 98 >SB_47049| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.69) Length = 178 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 132 RICDTGYIPLPRSLTRYARSFDCGE 156 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) Length = 180 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 134 RICDTGYIPLPRSLTRYARSFDCGE 158 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 83 AALMNRPTRGERRFAYW 99 >SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) Length = 178 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 132 RICDTGYIPLPRSLTRYARSFDCGE 156 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) Length = 178 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 132 RICDTGYIPLPRSLTRYARSFDCGE 156 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 81 AALMNRPTRGERRFAYW 97 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 131 RICDTGYIPLPRSLTRYARSFDCGE 155 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_35069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 129 RICDTGYIPLPRSLTRYARSFDCGE 153 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_16892| Best HMM Match : TIL (HMM E-Value=4.4) Length = 177 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 131 RICDTGYIPLPRSLTRYARSFDCGE 155 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 129 RICDTGYIPLPRSLTRYARSFDCGE 153 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 129 RICDTGYIPLPRSLTRYARSFDCGE 153 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 130 RICDTGYIPLPRSLTRYARSFDCGE 154 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 79 AALMNRPTRGERRFAYW 95 >SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) Length = 177 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 131 RICDTGYIPLPRSLTRYARSFDCGE 155 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 80 AALMNRPTRGERRFAYW 96 >SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 129 RICDTGYIPLPRSLTRYARSFDCGE 153 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 129 RICDTGYIPLPRSLTRYARSFDCGE 153 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 78 AALMNRPTRGERRFAYW 94 >SB_45699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 127 RICDTGYIPLPRSLTRYARSFDCGE 151 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 76 AALMNRPTRGERRFAYW 92 >SB_39283| Best HMM Match : ADK (HMM E-Value=3.7) Length = 171 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 125 RICDTGYIPLPRSLTRYARSFDCGE 149 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 74 AALMNRPTRGERRFAYW 90 >SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 125 RICDTGYIPLPRSLTRYARSFDCGE 149 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 74 AALMNRPTRGERRFAYW 90 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 125 RICDTGYIPLPRSLTRYARSFDCGE 149 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 74 AALMNRPTRGERRFAYW 90 >SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 120 RICDTGYIPLPRSLTRYARSFDCGE 144 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 69 AALMNRPTRGERRFAYW 85 >SB_33062| Best HMM Match : DUF485 (HMM E-Value=7.5) Length = 168 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 122 RICDTGYIPLPRSLTRYARSFDCGE 146 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_27679| Best HMM Match : zf-MYND (HMM E-Value=0.00039) Length = 167 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 121 RICDTGYIPLPRSLTRYARSFDCGE 145 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 122 RICDTGYIPLPRSLTRYARSFDCGE 146 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 71 AALMNRPTRGERRFAYW 87 >SB_9470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 121 RICDTGYIPLPRSLTRYARSFDCGE 145 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_28284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 121 RICDTGYIPLPRSLTRYARSFDCGE 145 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 121 RICDTGYIPLPRSLTRYARSFDCGE 145 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 70 AALMNRPTRGERRFAYW 86 >SB_941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 118 RICDTGYIPLPRSLTRYARSFDCGE 142 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 67 AALMNRPTRGERRFAYW 83 >SB_44336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 117 RICDTGYIPLPRSLTRYARSFDCGE 141 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 66 AALMNRPTRGERRFAYW 82 >SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 116 RICDTGYIPLPRSLTRYARSFDCGE 140 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 65 AALMNRPTRGERRFAYW 81 >SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 115 RICDTGYIPLPRSLTRYARSFDCGE 139 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 64 AALMNRPTRGERRFAYW 80 >SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) Length = 160 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 114 RICDTGYIPLPRSLTRYARSFDCGE 138 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 63 AALMNRPTRGERRFAYW 79 >SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 112 RICDTGYIPLPRSLTRYARSFDCGE 136 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 112 RICDTGYIPLPRSLTRYARSFDCGE 136 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 112 RICDTGYIPLPRSLTRYARSFDCGE 136 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_2945| Best HMM Match : NADH_dehy_S2_C (HMM E-Value=4.4) Length = 157 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 111 RICDTGYIPLPRSLTRYARSFDCGE 135 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_57559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 111 RICDTGYIPLPRSLTRYARSFDCGE 135 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 60 AALMNRPTRGERRFAYW 76 >SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 112 RICDTGYIPLPRSLTRYARSFDCGE 136 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 61 AALMNRPTRGERRFAYW 77 >SB_30119| Best HMM Match : VWC (HMM E-Value=2.1) Length = 155 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 109 RICDTGYIPLPRSLTRYARSFDCGE 133 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 58 AALMNRPTRGERRFAYW 74 >SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 110 RICDTGYIPLPRSLTRYARSFDCGE 134 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 59 AALMNRPTRGERRFAYW 75 >SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 110 RICDTGYIPLPRSLTRYARSFDCGE 134 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 59 AALMNRPTRGERRFAYW 75 >SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 108 RICDTGYIPLPRSLTRYARSFDCGE 132 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 57 AALMNRPTRGERRFAYW 73 >SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 106 RICDTGYIPLPRSLTRYARSFDCGE 130 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 55 AALMNRPTRGERRFAYW 71 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 107 RICDTGYIPLPRSLTRYARSFDCGE 131 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 56 AALMNRPTRGERRFAYW 72 >SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 107 RICDTGYIPLPRSLTRYARSFDCGE 131 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 56 AALMNRPTRGERRFAYW 72 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 102 RICDTGYIPLPRSLTRYARSFDCGE 126 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 51 AALMNRPTRGERRFAYW 67 >SB_36515| Best HMM Match : UPF0126 (HMM E-Value=0.73) Length = 150 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 104 RICDTGYIPLPRSLTRYARSFDCGE 128 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_24766| Best HMM Match : Plasmid_stabil (HMM E-Value=7.3) Length = 149 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 103 RICDTGYIPLPRSLTRYARSFDCGE 127 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_24481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) Length = 150 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 104 RICDTGYIPLPRSLTRYARSFDCGE 128 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 53 AALMNRPTRGERRFAYW 69 >SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 103 RICDTGYIPLPRSLTRYARSFDCGE 127 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 52 AALMNRPTRGERRFAYW 68 >SB_45327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 101 RICDTGYIPLPRSLTRYARSFDCGE 125 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 100 RICDTGYIPLPRSLTRYARSFDCGE 124 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 100 RICDTGYIPLPRSLTRYARSFDCGE 124 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 100 RICDTGYIPLPRSLTRYARSFDCGE 124 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 101 RICDTGYIPLPRSLTRYARSFDCGE 125 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 99 RICDTGYIPLPRSLTRYARSFDCGE 123 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_33325| Best HMM Match : ShTK (HMM E-Value=6.3e-10) Length = 147 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 101 RICDTGYIPLPRSLTRYARSFDCGE 125 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 50 AALMNRPTRGERRFAYW 66 >SB_15771| Best HMM Match : VQ (HMM E-Value=4.3) Length = 145 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 99 RICDTGYIPLPRSLTRYARSFDCGE 123 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 48 AALMNRPTRGERRFAYW 64 >SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 100 RICDTGYIPLPRSLTRYARSFDCGE 124 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 49 AALMNRPTRGERRFAYW 65 >SB_59645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 98 RICDTGYIPLPRSLTRYARSFDCGE 122 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 47 AALMNRPTRGERRFAYW 63 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 97 RICDTGYIPLPRSLTRYARSFDCGE 121 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 46 AALMNRPTRGERRFAYW 62 >SB_12| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 93 RICDTGYIPLPRSLTRYARSFDCGE 117 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_39914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 95 RICDTGYIPLPRSLTRYARSFDCGE 119 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_54599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 93 RICDTGYIPLPRSLTRYARSFDCGE 117 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 96 RICDTGYIPLPRSLTRYARSFDCGE 120 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 45 AALMNRPTRGERRFAYW 61 >SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 93 RICDTGYIPLPRSLTRYARSFDCGE 117 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 93 RICDTGYIPLPRSLTRYARSFDCGE 117 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 42 AALMNRPTRGERRFAYW 58 >SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 95 RICDTGYIPLPRSLTRYARSFDCGE 119 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 95 RICDTGYIPLPRSLTRYARSFDCGE 119 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 44 AALMNRPTRGERRFAYW 60 >SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 92 RICDTGYIPLPRSLTRYARSFDCGE 116 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_52037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 91 RICDTGYIPLPRSLTRYARSFDCGE 115 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 92 RICDTGYIPLPRSLTRYARSFDCGE 116 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 91 RICDTGYIPLPRSLTRYARSFDCGE 115 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 90 RICDTGYIPLPRSLTRYARSFDCGE 114 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_1908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 92 RICDTGYIPLPRSLTRYARSFDCGE 116 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 92 RICDTGYIPLPRSLTRYARSFDCGE 116 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_53936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 90 RICDTGYIPLPRSLTRYARSFDCGE 114 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_50527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 91 RICDTGYIPLPRSLTRYARSFDCGE 115 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 91 RICDTGYIPLPRSLTRYARSFDCGE 115 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 90 RICDTGYIPLPRSLTRYARSFDCGE 114 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 91 RICDTGYIPLPRSLTRYARSFDCGE 115 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 91 RICDTGYIPLPRSLTRYARSFDCGE 115 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 40 AALMNRPTRGERRFAYW 56 >SB_27082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 92 RICDTGYIPLPRSLTRYARSFDCGE 116 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 41 AALMNRPTRGERRFAYW 57 >SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) Length = 136 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 90 RICDTGYIPLPRSLTRYARSFDCGE 114 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 39 AALMNRPTRGERRFAYW 55 >SB_5713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 88 RICDTGYIPLPRSLTRYARSFDCGE 112 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 87 RICDTGYIPLPRSLTRYARSFDCGE 111 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_22087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 88 RICDTGYIPLPRSLTRYARSFDCGE 112 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 87 RICDTGYIPLPRSLTRYARSFDCGE 111 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 36 AALMNRPTRGERRFAYW 52 >SB_13637| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 88 RICDTGYIPLPRSLTRYARSFDCGE 112 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 37 AALMNRPTRGERRFAYW 53 >SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 84 RICDTGYIPLPRSLTRYARSFDCGE 108 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 33 AALMNRPTRGERRFAYW 49 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 84 RICDTGYIPLPRSLTRYARSFDCGE 108 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 33 AALMNRPTRGERRFAYW 49 >SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 83 RICDTGYIPLPRSLTRYARSFDCGE 107 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 32 AALMNRPTRGERRFAYW 48 >SB_19974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 59 RICDTGYIPLPRSLTRYARSFDCGE 83 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_27625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 59 RICDTGYIPLPRSLTRYARSFDCGE 83 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 8 AALMNRPTRGERRFAYW 24 >SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 81 RICDTGYIPLPRSLTRYARSFDCGE 105 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 30 AALMNRPTRGERRFAYW 46 >SB_6524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 81 RICDTGYIPLPRSLTRYARSFDCGE 105 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 30 AALMNRPTRGERRFAYW 46 >SB_21115| Best HMM Match : Swi3 (HMM E-Value=6.9) Length = 125 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 79 RICDTGYIPLPRSLTRYARSFDCGE 103 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 28 AALMNRPTRGERRFAYW 44 >SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 78 RICDTGYIPLPRSLTRYARSFDCGE 102 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 27 AALMNRPTRGERRFAYW 43 >SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 79 RICDTGYIPLPRSLTRYARSFDCGE 103 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 28 AALMNRPTRGERRFAYW 44 >SB_59194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_58639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_55179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_51499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_49138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_44738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 >SB_42360| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 34.7 bits (76), Expect(2) = 2e-05 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +2 Query: 617 RVAYWGALPVPRSLTPCARSFGCGE 691 R+ G +P+PRSLT ARSF CGE Sbjct: 76 RICDTGYIPLPRSLTRYARSFDCGE 100 Score = 31.9 bits (69), Expect(2) = 2e-05 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = +2 Query: 581 SALMNRPTXGXKRVAYW 631 +ALMNRPT G +R AYW Sbjct: 25 AALMNRPTRGERRFAYW 41 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,020,590 Number of Sequences: 59808 Number of extensions: 311074 Number of successful extensions: 1655 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1098 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1649 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2550281014 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -