BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M21 (937 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 35 0.11 06_02_0257 - 13533689-13533714,13533799-13533925,13534013-135341... 34 0.14 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 34 0.19 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 31 0.19 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 33 0.25 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 33 0.33 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 33 0.43 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 32 0.57 03_02_0784 - 11154395-11154888,11155284-11155360,11155447-111554... 32 0.75 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 31 1.00 04_04_0176 - 23329589-23331043 31 1.00 12_02_0299 - 17051570-17052474,17053542-17053755 31 1.3 11_01_0333 + 2490132-2491007 31 1.3 09_04_0368 + 17005231-17005437,17005707-17005963,17006061-170061... 31 1.3 06_01_0893 - 6834350-6834464,6835042-6835218,6835301-6835350,683... 31 1.3 02_04_0520 - 23628183-23628195,23629354-23630036 31 1.3 02_04_0122 - 19959137-19960043,19960150-19960714,19960932-19961202 31 1.3 08_02_1237 + 25475219-25475916,25476127-25476320,25476407-254773... 31 1.7 08_02_1019 - 23657175-23658047 31 1.7 08_02_0864 + 21994286-21994989,21996257-21996958,21997221-219973... 31 1.7 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 31 1.7 07_03_1495 + 26983415-26984797 31 1.7 08_02_1063 + 24024030-24024506,24024803-24024856,24024965-240251... 30 2.3 08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147,160... 30 2.3 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 30 2.3 04_04_0708 - 27441373-27442611 30 2.3 04_01_0354 - 4646826-4647314 30 2.3 01_06_1321 + 36280691-36281269 30 2.3 02_05_0686 - 30900748-30902167,30903442-30904742 28 2.7 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 30 3.0 10_02_0009 + 4128909-4130123 30 3.0 07_03_1771 - 29404972-29405175,29405282-29405677 30 3.0 06_02_0108 - 11917186-11917207,11917834-11917943,11918116-11918544 30 3.0 05_04_0392 - 20889699-20891726 30 3.0 01_06_0308 - 28369843-28370925,28372249-28372944 30 3.0 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 29 3.5 01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593,703... 27 3.6 06_03_0743 + 24069752-24070483,24071890-24072345 27 3.7 08_02_0937 + 22801526-22802461 25 3.8 07_01_0080 + 587674-588510 29 4.0 04_04_0746 + 27726736-27727118,27727518-27727544,27728042-277281... 29 4.0 03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 28 4.6 01_06_1521 + 37956131-37957204,37958560-37958962,37959370-379594... 25 4.7 12_02_1174 - 26696869-26698191 29 5.3 12_02_1070 - 25814741-25815850 29 5.3 11_06_0756 + 26952196-26952264,26952760-26953206,26954009-269553... 29 5.3 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 29 5.3 09_02_0327 - 7284829-7284889,7284946-7286126 29 5.3 07_03_0866 - 22134215-22135351 29 5.3 07_01_0282 - 2070027-2070041,2074763-2075062,2075154-2075722,207... 29 5.3 05_07_0089 - 27619053-27620138 29 5.3 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 5.3 04_04_1687 - 35365766-35366356,35367137-35368135 29 5.3 04_04_1104 - 30928475-30928501,30929008-30929110,30929287-309293... 29 5.3 04_03_1022 - 21778315-21779007 29 5.3 03_06_0599 + 34984869-34985319,34986581-34987563 29 5.3 02_04_0255 - 21323382-21323966 29 5.3 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 24 5.7 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 24 6.4 05_04_0011 + 17139322-17139451,17139552-17140174 25 6.5 12_02_0326 + 17555731-17556387 29 7.0 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 29 7.0 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 29 7.0 08_02_1256 + 25645085-25645396 29 7.0 08_02_0732 + 20521459-20522323,20522404-20522480,20523251-205232... 29 7.0 08_01_0060 - 413088-413999 29 7.0 07_03_1136 + 24218601-24218734,24218769-24219906 29 7.0 07_03_0111 + 13535912-13535972,13536081-13536142,13536418-135365... 29 7.0 07_01_0678 - 5103836-5104613,5104697-5104888,5104994-5105036,510... 29 7.0 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 29 7.0 04_04_0198 + 23502657-23502900,23505228-23505298,23505690-235057... 29 7.0 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 29 7.0 04_03_0874 + 20467608-20468306,20468575-20468736,20470083-204701... 29 7.0 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 29 7.0 03_01_0023 + 198414-198968 29 7.0 02_04_0083 + 19566476-19566539,19566781-19567006,19567206-195673... 29 7.0 02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396,105... 29 7.0 01_07_0079 - 40934918-40935301 29 7.0 01_06_1107 + 34568091-34568341,34568455-34568540,34569204-345692... 29 7.0 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 29 7.0 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 29 7.0 01_01_0162 - 1394980-1395760,1396024-1396037 29 7.0 01_01_0159 + 1380421-1381143 29 7.0 01_06_0264 + 28005997-28006823,28007107-28007290,28007603-28007701 25 8.2 12_02_0896 + 24100015-24100240,24100910-24101277,24102144-241023... 28 9.3 12_01_0495 - 3935395-3937110 28 9.3 12_01_0373 + 2897874-2898911 28 9.3 11_06_0208 - 21268722-21268763,21269146-21269274,21269388-212695... 28 9.3 11_06_0016 - 19284810-19284926,19285527-19286879 28 9.3 11_01_0621 - 4981070-4981136,4982906-4983825 28 9.3 10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 28 9.3 10_08_0534 + 18595520-18595828,18595917-18597149 28 9.3 10_07_0053 - 12406958-12407011,12407012-12407168,12407280-124074... 28 9.3 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 28 9.3 10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136,713... 28 9.3 09_06_0188 - 21441377-21442201 28 9.3 09_06_0107 + 20907560-20908491,20908511-20908625,20908967-209090... 28 9.3 09_04_0745 + 19884868-19886000,19886110-19886309,19886422-198866... 28 9.3 09_03_0130 - 12609417-12610462,12610786-12611040,12611139-126112... 28 9.3 08_02_0796 - 21300251-21300373,21300846-21301721 28 9.3 07_03_1530 + 27502546-27502671,27503487-27503561,27504670-275047... 28 9.3 07_03_0154 + 14509979-14512033 28 9.3 07_01_0862 - 7172083-7172931 28 9.3 07_01_0753 - 5799733-5799741,5799938-5800642 28 9.3 06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 28 9.3 05_07_0066 + 27453611-27453627,27454729-27454872,27455998-274566... 28 9.3 05_07_0031 - 27183252-27183317,27183542-27184282 28 9.3 05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102,300... 28 9.3 05_01_0380 + 2978256-2979284 28 9.3 05_01_0210 + 1583176-1584177 28 9.3 04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 28 9.3 04_04_0360 - 24684159-24684565,24684654-24685089 28 9.3 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 28 9.3 04_01_0197 + 2323790-2324098,2324145-2324774 28 9.3 04_01_0080 - 889548-889892 28 9.3 04_01_0034 - 401208-402923 28 9.3 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 28 9.3 03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 28 9.3 03_02_0738 - 10824121-10825572 28 9.3 02_03_0279 + 17250347-17252098 28 9.3 02_01_0674 + 5020118-5020202,5020301-5020436,5021075-5021140,502... 28 9.3 02_01_0062 - 448105-448145,448780-448866,449664-449790 28 9.3 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 28 9.3 01_06_0357 - 28668894-28669238,28669510-28669537,28669578-286696... 28 9.3 01_05_0490 + 22672241-22674679 28 9.3 01_01_0046 - 331758-332627 28 9.3 01_05_0292 + 20518668-20519090,20519213-20519281,20520204-205204... 26 9.8 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 34.7 bits (76), Expect = 0.11 Identities = 13/23 (56%), Positives = 13/23 (56%) Frame = +1 Query: 379 LECLFVVLTPXPPXXPPXPPPXP 447 L C F L P PP PP PPP P Sbjct: 29 LRCPFTFLCPPPPPPPPPPPPPP 51 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = +3 Query: 390 VCSTYXXPXPPPPPXXPPP 446 +C P PPPPP PPP Sbjct: 36 LCPPPPPPPPPPPPPPPPP 54 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +1 Query: 406 PXPPXXPPXPPPXPXXXXVPGAR 474 P PP PP PPP P P R Sbjct: 43 PPPPPPPPPPPPPPLEVVSPSPR 65 >06_02_0257 - 13533689-13533714,13533799-13533925,13534013-13534121, 13534193-13534272,13534758-13534979,13536070-13536318, 13537032-13537484,13539834-13540556 Length = 662 Score = 34.3 bits (75), Expect = 0.14 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGPGXXPLXRV 497 PPPPP PP G GGPG R+ Sbjct: 63 PPPPPPPPPSSAAAGGGGPGMTTSFRI 89 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 33.9 bits (74), Expect = 0.19 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGG 470 P PPPPP PPP G GG Sbjct: 9 PPPPPPPQHPPPPQAGGGGG 28 Score = 31.9 bits (69), Expect = 0.75 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPG 476 P PPPPP PP G GG G Sbjct: 8 PPPPPPPPQHPPPPQAGGGGGG 29 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 31.5 bits (68), Expect(2) = 0.19 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXP 485 P PPPPP PP G G P P Sbjct: 689 PPPPPPPPLPPANRTNGPGVPSAPP 713 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 563 PPPPPPPPPPPP 574 Score = 25.8 bits (54), Expect(2) = 1.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 396 STYXXPXPPPPPXXPP 443 S Y PPPPP PP Sbjct: 578 SNYASSQPPPPPPPPP 593 Score = 25.8 bits (54), Expect(2) = 2.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 417 PPPPPXXPPP 446 PPPPP PPP Sbjct: 634 PPPPPPPPPP 643 Score = 23.4 bits (48), Expect(2) = 1.6 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGPGXXP 485 PPPPP P P S P P Sbjct: 586 PPPPPPPPLPNCLVPSPPPPPPP 608 Score = 22.6 bits (46), Expect(2) = 2.6 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +3 Query: 411 PXPPPPPXXP 440 P PPPPP P Sbjct: 586 PPPPPPPPLP 595 Score = 21.0 bits (42), Expect(2) = 0.19 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 402 YXXPXPPPPP 431 + P PPPPP Sbjct: 662 FPAPPPPPPP 671 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 33.5 bits (73), Expect = 0.25 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 484 GXIPGPPEPXXXXGGGXXGGGGGXG 410 G PG P P GGG GGGGG G Sbjct: 390 GGGPGAPPPYHGGGGGGGGGGGGGG 414 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 33.1 bits (72), Expect = 0.33 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 381 RMSVCSTYXXPXPPPPPXXPPP 446 +++ CS+ P PPPPP PPP Sbjct: 229 KVAGCSSVRPPPPPPPPPLPPP 250 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 306 PIPPPPPPPPPP 317 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 32.7 bits (71), Expect = 0.43 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 402 YXXPXPPPPPXXPPPXXXXGSGGPG 476 + P PPPPP PPP + GPG Sbjct: 51 FLAPPPPPPPGPPPPHQPQFNFGPG 75 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 107 PPPPPPPPSPPP 118 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 122 PPPPPPPTQPPP 133 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 32.3 bits (70), Expect = 0.57 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXP 485 P PPPPP PPP G P P Sbjct: 365 PPPPPPPRPPPPPPPIKKGAPPPAP 389 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXPLXR 494 P PPPPP PPP P P+ + Sbjct: 355 PPPPPPPPPPPPPPPPPRPPPPPPPIKK 382 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 406 PXPPXXPPXPPPXPXXXXVPGARG 477 P PP PP PPP P P +G Sbjct: 360 PPPPPPPPPPPPRPPPPPPPIKKG 383 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +1 Query: 400 LTPXPPXXPPXPPPXP 447 L P PP PP PPP P Sbjct: 351 LMPPPPPPPPPPPPPP 366 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 397 VLTPXPPXXPPXPPPXP 447 ++ P PP PP PPP P Sbjct: 351 LMPPPPPPPPPPPPPPP 367 >03_02_0784 - 11154395-11154888,11155284-11155360,11155447-11155497, 11155599-11155672,11156127-11156215,11156533-11156618, 11157570-11157669,11158540-11158622,11158776-11159194 Length = 490 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +3 Query: 363 IHVNKIRMSVCSTYXXPXPPPPPXXPPP 446 IH N ++ C P PPPPP PPP Sbjct: 413 IH-NLLQFQPCGPPYAPPPPPPPPPPPP 439 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 412 PPXXPPXPPPXPXXXXVPGA 471 PP PP PPP P +PG+ Sbjct: 428 PPPPPPPPPPPPQALPLPGS 447 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 31.5 bits (68), Expect = 1.00 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 394 VVLTPXPPXXPPXPPPXP 447 VV+ P PP PP PPP P Sbjct: 35 VVIAPPPPPPPPPPPPAP 52 >04_04_0176 - 23329589-23331043 Length = 484 Score = 31.5 bits (68), Expect = 1.00 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 469 PPEPXXXXGGGXXGGGGGXG 410 PP P GGG GGGGG G Sbjct: 260 PPRPQLPFGGGMLGGGGGAG 279 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = +3 Query: 396 STYXXPXPPPPPXXPPP 446 S Y P PPPPP PPP Sbjct: 315 SFYPSPPPPPPPPPPPP 331 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 321 PPPPPPPPPPPP 332 >11_01_0333 + 2490132-2491007 Length = 291 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGG 470 PPPPP PPP G GG Sbjct: 199 PPPPPSFPPPIRSIGRGG 216 >09_04_0368 + 17005231-17005437,17005707-17005963,17006061-17006115, 17006196-17006276,17006357-17006453,17006560-17006627, 17006788-17006886,17007008-17007049,17007124-17007263, 17007882-17008018,17008275-17008444 Length = 450 Score = 31.1 bits (67), Expect = 1.3 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGPGXXPLXRVNWXPNMIKXF 527 P PPP PPP G GG G +W PN++ F Sbjct: 15 PWPPP--PPPGSSSGRGGGGGGGGDPGDWKPNVVAAF 49 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 475 PGPPEPXXXXGGGXXGGGGGXG 410 P PP P G GGGGG G Sbjct: 15 PWPPPPPPGSSSGRGGGGGGGG 36 >06_01_0893 - 6834350-6834464,6835042-6835218,6835301-6835350, 6836348-6836416,6836495-6836593,6836681-6836759, 6837604-6837704,6838645-6838713,6839548-6839588, 6839793-6841159,6841472-6841575,6841914-6842351, 6843040-6843567 Length = 1078 Score = 31.1 bits (67), Expect = 1.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -1 Query: 469 PPEPXXXXGGGXXGGGGGXG 410 PP P GGG GGGGG G Sbjct: 23 PPPPVSKKGGGGGGGGGGGG 42 >02_04_0520 - 23628183-23628195,23629354-23630036 Length = 231 Score = 31.1 bits (67), Expect = 1.3 Identities = 13/36 (36%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 366 HVNKIRMSVCSTYXXPXPPPPP-XXPPPXXXXGSGG 470 H+ + + +T P PPPPP PPP GG Sbjct: 180 HIMLVDFDLSTTLPPPPPPPPPDTAPPPQTARSRGG 215 >02_04_0122 - 19959137-19960043,19960150-19960714,19960932-19961202 Length = 580 Score = 31.1 bits (67), Expect = 1.3 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +1 Query: 403 TPXPPXXPPXPPPXPXXXXVP 465 TP PP PP PPP P +P Sbjct: 89 TPVPPPFPPAPPPPPNQNNLP 109 >08_02_1237 + 25475219-25475916,25476127-25476320,25476407-25477302, 25477416-25477490,25477582-25477689,25477780-25477897, 25478007-25478142,25478228-25478372,25478460-25479080, 25479166-25479597 Length = 1140 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 500 INPX*RXXPRAPGTXXXXGXGGGXGGXXGGXGVS 399 + P R +PG+ G GGG GG GG G S Sbjct: 150 VRPSKRVRSGSPGSASGGGGGGGGGGNSGGGGGS 183 >08_02_1019 - 23657175-23658047 Length = 290 Score = 30.7 bits (66), Expect = 1.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -1 Query: 472 GPPEPXXXXGGGXXGGGGGXG 410 G P+P GGG GGGGG G Sbjct: 38 GVPKPGGGVGGGGGGGGGGGG 58 >08_02_0864 + 21994286-21994989,21996257-21996958,21997221-21997374, 21997494-21997838,21998323-21999240,21999312-21999640, 21999709-21999832,21999901-22000071,22000188-22001648, 22002647-22002910,22003866-22004189 Length = 1831 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +3 Query: 420 PPPPXXPPPXXXXGSGGPG 476 PPPP PPP G+GG G Sbjct: 28 PPPPLPPPPASQVGAGGGG 46 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 30.7 bits (66), Expect = 1.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +1 Query: 391 FVVLTPXPPXXPPXPPPXPXXXXVP 465 + L P PP PP PPP P +P Sbjct: 421 YTELPPPPPLPPPPPPPPPPPPPLP 445 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 400 LTPXPPXXPPXPPPXPXXXXVP 465 L P PP PP PPP P P Sbjct: 430 LPPPPPPPPPPPPPLPPNMPPP 451 >07_03_1495 + 26983415-26984797 Length = 460 Score = 30.7 bits (66), Expect = 1.7 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -1 Query: 484 GXIPGPPEPXXXXGGGXXGGGGGXGLX*VLQT 389 G PP GGG GGGGG G +L+T Sbjct: 32 GSTSTPPTDDDVGGGGGGGGGGGWGFGGLLKT 63 >08_02_1063 + 24024030-24024506,24024803-24024856,24024965-24025118, 24025314-24025388,24025511-24025788,24026023-24026253, 24026522-24026620,24026740-24026889,24027830-24027976, 24028525-24028575,24028647-24028819,24029018-24029147, 24029361-24029458,24029655-24029892,24030634-24030837, 24031003-24031083,24031296-24031535 Length = 959 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 472 GPPEPXXXXGGGXXGGGGGXG 410 GPP GGG GGGGG G Sbjct: 108 GPPRGGGGGGGGDGGGGGGGG 128 >08_01_0193 + 1599970-1600503,1601488-1601919,1602010-1602147, 1602532-1602600 Length = 390 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGP 473 PPPPP PPP GS P Sbjct: 19 PPPPPPPPPPLPPRGSPAP 37 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 30.3 bits (65), Expect = 2.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +1 Query: 388 LFVVLTPXPPXXPPXPPPXP 447 + +L P PP PP PPP P Sbjct: 92 VLAILPPPPPELPPPPPPPP 111 >04_04_0708 - 27441373-27442611 Length = 412 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +3 Query: 378 IRMSVCSTYXXPXPPPPPXXPP 443 + +S CS P PPPPP PP Sbjct: 230 LTLSPCSPPLLPPPPPPPPPPP 251 >04_01_0354 - 4646826-4647314 Length = 162 Score = 30.3 bits (65), Expect = 2.3 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXP 485 P PPPPP PPP PG P Sbjct: 93 PPPPPPPPPPPPQQQQQCYCPGDRP 117 >01_06_1321 + 36280691-36281269 Length = 192 Score = 30.3 bits (65), Expect = 2.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = +1 Query: 406 PXPPXXPPXPPPXPXXXXVP 465 P PP PP PPP P VP Sbjct: 145 PSPPPPPPPPPPLPPAMYVP 164 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 366 HVNKIRMSVCSTYXXPXPPPPPXXPPP 446 H+ K R+ + T PPP P PPP Sbjct: 126 HLQKYRLYLKRTRVAATPPPSPPPPPP 152 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/28 (50%), Positives = 14/28 (50%), Gaps = 3/28 (10%) Frame = +3 Query: 411 PXPPPP--PXXPPPXXXXG-SGGPGXXP 485 P PPPP P PPP G GGP P Sbjct: 354 PPPPPPKGPSPPPPPPPGGKKGGPPPPP 381 Score = 26.2 bits (55), Expect(2) = 2.7 Identities = 10/23 (43%), Positives = 10/23 (43%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGPGXXP 485 PPPPP PP G P P Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPP 358 Score = 22.2 bits (45), Expect(2) = 2.7 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 411 PXPPPPPXXPP 443 P PPPPP P Sbjct: 311 PAPPPPPPPKP 321 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGS-GGPGXXP 485 P PP PP PPP G GGP P Sbjct: 615 PPPPRPPGAPPPPPPPGKPGGPPPPP 640 >10_02_0009 + 4128909-4130123 Length = 404 Score = 29.9 bits (64), Expect = 3.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 378 IRMSVCSTYXXPXPPPPPXXPPP 446 +R+ + ST P PP PP PPP Sbjct: 68 LRLVLSSTSTSPSPPSPPPPPPP 90 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 403 TPXPPXXPPXPPPXPXXXXVP 465 +P PP PP PPP P P Sbjct: 78 SPSPPSPPPPPPPPPPQQPAP 98 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 375 KIRMSVCSTYXXPXPPPPPXXPPP 446 ++ +S ST P PPPP PPP Sbjct: 69 RLVLSSTSTSPSPPSPPPPPPPPP 92 >07_03_1771 - 29404972-29405175,29405282-29405677 Length = 199 Score = 29.9 bits (64), Expect = 3.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 394 VVLTPXPPXXPPXPPPXP 447 +V +P PP PP PPP P Sbjct: 10 IVKSPLPPPPPPPPPPLP 27 >06_02_0108 - 11917186-11917207,11917834-11917943,11918116-11918544 Length = 186 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = -1 Query: 487 KGXIPGPPEPXXXXG-GGXXGGGGGXG 410 +G +P PP P G G GGGGG G Sbjct: 108 RGPVPAPPLPLLGEGEDGGGGGGGGVG 134 >05_04_0392 - 20889699-20891726 Length = 675 Score = 29.9 bits (64), Expect = 3.0 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = -1 Query: 469 PPEPXXXXGGGXXGGGGGXGLX*VLQTDILILFTCIDLHNFINIQI 332 PP P GGG GGGG V+ D+ ++C+ ++ ++I Sbjct: 26 PPPPAGAKGGGAKSGGGGGT---VIGIDLGTTYSCVGVYRNDRVEI 68 >01_06_0308 - 28369843-28370925,28372249-28372944 Length = 592 Score = 29.9 bits (64), Expect = 3.0 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = -1 Query: 520 FIMXGIQLTLXKGXIPGPPEPXXXXGGGXXGGGGGXG 410 F++ + TL +P PP P GG GG G G Sbjct: 5 FLLPLLLSTLLPAAVPLPPRPPVRCGGSGGAGGDGAG 41 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/26 (50%), Positives = 13/26 (50%), Gaps = 1/26 (3%) Frame = +3 Query: 411 PXPPPP-PXXPPPXXXXGSGGPGXXP 485 P PP P P PPP G GG G P Sbjct: 361 PRPPGPGPGPPPPPGAAGRGGGGPPP 386 Score = 25.0 bits (52), Expect(2) = 3.5 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPP PPP Sbjct: 273 PAAPPPPAGPPP 284 Score = 24.6 bits (51), Expect(2) = 7.6 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 420 PPPPXXPPPXXXXGSGGPGXXP 485 PPPP P GSG P P Sbjct: 333 PPPPAPSPSAAGAGSGPPPPPP 354 Score = 23.0 bits (47), Expect(2) = 3.5 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 420 PPPPXXPPPXXXXGSGGPGXXP 485 PPPP PP G+G P Sbjct: 302 PPPPHPLPPGAGAGAGTGAPPP 323 Score = 22.2 bits (45), Expect(2) = 7.6 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 411 PXPPPPPXXPP 443 P PP PP PP Sbjct: 282 PPPPAPPPLPP 292 >01_01_0892 + 7037384-7037795,7038447-7038962,7039507-7039593, 7039698-7039768,7040148-7040224,7040380-7040527, 7040973-7041134,7041374-7041694 Length = 597 Score = 27.5 bits (58), Expect(2) = 3.6 Identities = 10/18 (55%), Positives = 10/18 (55%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGG 470 PPPPP PPP GG Sbjct: 126 PPPPPPPPPPFKGDHYGG 143 Score = 20.6 bits (41), Expect(2) = 3.6 Identities = 6/7 (85%), Positives = 6/7 (85%) Frame = +3 Query: 411 PXPPPPP 431 P PPPPP Sbjct: 111 PPPPPPP 117 >06_03_0743 + 24069752-24070483,24071890-24072345 Length = 395 Score = 27.1 bits (57), Expect(2) = 3.7 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSG 467 PPPPP PPP SG Sbjct: 25 PPPPPPPPPPYAASFSG 41 Score = 21.0 bits (42), Expect(2) = 3.7 Identities = 6/10 (60%), Positives = 7/10 (70%) Frame = +3 Query: 402 YXXPXPPPPP 431 + P PPPPP Sbjct: 24 FPPPPPPPPP 33 >08_02_0937 + 22801526-22802461 Length = 311 Score = 25.0 bits (52), Expect(2) = 3.8 Identities = 9/15 (60%), Positives = 9/15 (60%) Frame = +3 Query: 396 STYXXPXPPPPPXXP 440 ST P PPPPP P Sbjct: 28 STVSLPPPPPPPSRP 42 Score = 23.0 bits (47), Expect(2) = 3.8 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 420 PPPPXXPPP 446 PPPP PPP Sbjct: 73 PPPPPPPPP 81 >07_01_0080 + 587674-588510 Length = 278 Score = 29.5 bits (63), Expect = 4.0 Identities = 11/21 (52%), Positives = 11/21 (52%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGP 473 P PPPPP PPP S P Sbjct: 110 PPPPPPPPPPPPLFTRRSHAP 130 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 104 PPPPPPPPPPPP 115 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 105 PPPPPPPPPPPP 116 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 106 PPPPPPPPPPPP 117 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 107 PPPPPPPPPPPP 118 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 108 PPPPPPPPPPPP 119 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 109 PPPPPPPPPPPP 120 >04_04_0746 + 27726736-27727118,27727518-27727544,27728042-27728126, 27729252-27729809 Length = 350 Score = 29.5 bits (63), Expect = 4.0 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = +1 Query: 403 TPXPPXXPPXPPPXP 447 TP PP PP PPP P Sbjct: 32 TPPPPALPPPPPPTP 46 >03_05_0918 - 28785233-28786613,28786894-28787140,28787773-28788238 Length = 697 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 14 PTPPPPPPPPPP 25 Score = 25.8 bits (54), Expect(2) = 4.6 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +3 Query: 417 PPPPPXXPPP 446 PPPPP PPP Sbjct: 17 PPPPPPPPPP 26 Score = 21.8 bits (44), Expect(2) = 4.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 381 RMSVCSTYXXPXPPPPP 431 R++ T P PPPPP Sbjct: 9 RLASWPTPPPPPPPPPP 25 >01_06_1521 + 37956131-37957204,37958560-37958962,37959370-37959471, 37959569-37959792 Length = 600 Score = 24.6 bits (51), Expect(2) = 4.7 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 445 GGGXXGGGGGXG 410 GGG GGGGG G Sbjct: 91 GGGAGGGGGGGG 102 Score = 23.0 bits (47), Expect(2) = 4.7 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -1 Query: 466 PEPXXXXGGGXXGGGG 419 PE GGG GGGG Sbjct: 41 PEKSVGGGGGGGGGGG 56 >12_02_1174 - 26696869-26698191 Length = 440 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +1 Query: 400 LTPXPPXXPPXPPPXPXXXXVP 465 L P PP PP PPP P P Sbjct: 152 LPPPPPPPPPPPPPRPPSVKPP 173 >12_02_1070 - 25814741-25815850 Length = 369 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = +3 Query: 375 KIRMSVCSTYXXPXPPPPPXXPPP 446 KIR+S P PPPPP PPP Sbjct: 228 KIRLSPTQA---PPPPPPPPPPPP 248 >11_06_0756 + 26952196-26952264,26952760-26953206,26954009-26955358, 26955400-26955408 Length = 624 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = -3 Query: 734 AEKXPXPXPPPXTLETIKKERPIGXXG 654 A K P P PPP +ERP G G Sbjct: 537 ARKLPPPPPPPPAAAEAARERPSGCDG 563 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 402 YXXPXPPPPPXXPPPXXXXGSGG 470 Y P PPP PPP G GG Sbjct: 258 YSVPSARPPPLLPPPCYSGGGGG 280 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXG 461 P PPPPP PPP G Sbjct: 53 PPPPPPPPPPPPPPPRG 69 Score = 28.7 bits (61), Expect = 7.0 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = +3 Query: 390 VCSTYXXPXPPPPPXXPPP 446 + + P PPPPP PPP Sbjct: 48 IFGAHPPPPPPPPPPPPPP 66 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 376 KLECLFVVLTPXPPXXPPXPPPXP 447 K +F P PP PP PPP P Sbjct: 44 KERIIFGAHPPPPPPPPPPPPPPP 67 >07_03_0866 - 22134215-22135351 Length = 378 Score = 29.1 bits (62), Expect = 5.3 Identities = 12/22 (54%), Positives = 12/22 (54%) Frame = -1 Query: 475 PGPPEPXXXXGGGXXGGGGGXG 410 P PP P GG GGGGG G Sbjct: 24 PLPPAPHGNGHGGGGGGGGGGG 45 >07_01_0282 - 2070027-2070041,2074763-2075062,2075154-2075722, 2075812-2076337 Length = 469 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGPGXXP 485 PPPPP PP GS P P Sbjct: 426 PPPPPPHPPSPSAEGSASPPTTP 448 >05_07_0089 - 27619053-27620138 Length = 361 Score = 29.1 bits (62), Expect = 5.3 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 469 PPEPXXXXGGGXXGGGGGXG 410 PP+ GGG GGGGG G Sbjct: 133 PPQASGSAGGGGGGGGGGGG 152 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXG 461 P PPPPP PPP G Sbjct: 216 PQPPPPPPPPPPDSKPG 232 >04_04_1687 - 35365766-35366356,35367137-35368135 Length = 529 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 396 STYXXPXPPPPPXXPPP 446 +T P PPPPP PPP Sbjct: 7 ATAPPPPPPPPPPPPPP 23 >04_04_1104 - 30928475-30928501,30929008-30929110,30929287-30929340, 30929803-30929895,30930063-30930140,30930416-30930527, 30930618-30930756,30930823-30930910,30930984-30931079, 30931675-30931781,30931874-30932009,30932089-30932186, 30932954-30933047,30933132-30933301,30933749-30933819, 30936066-30936194,30936552-30936654,30936764-30936907, 30937123-30937245,30937482-30937563,30939044-30939120, 30939261-30939315,30939365-30939443,30939544-30939620, 30939739-30939869,30939947-30940120,30940245-30940310, 30940937-30941572 Length = 1113 Score = 29.1 bits (62), Expect = 5.3 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +3 Query: 387 SVCSTYXXPXPPPPPXXPPPXXXXGSGGPGXXP 485 S S P PP P PPP G GG P Sbjct: 57 SSSSAAATPAPPAPAAPPPPTSRRGGGGGAALP 89 >04_03_1022 - 21778315-21779007 Length = 230 Score = 29.1 bits (62), Expect = 5.3 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +3 Query: 393 CSTYXXPXPPPPPXXPPPXXXXGSGGPGXXPLXRVNWXPN 512 CS+ PPPPP PPP P P + PN Sbjct: 29 CSSAHLLPPPPPPPPPPPYVPPHLLPPSPAPQQWYDHPPN 68 >03_06_0599 + 34984869-34985319,34986581-34987563 Length = 477 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 396 STYXXPXPPPPPXXPPP 446 S+ P PPPPP PPP Sbjct: 391 SSQSGPAPPPPPQPPPP 407 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 406 PXPPXXPPXPPPXPXXXXVP 465 P PP PP PPP P P Sbjct: 399 PPPPQPPPPPPPPPHQRETP 418 >02_04_0255 - 21323382-21323966 Length = 194 Score = 29.1 bits (62), Expect = 5.3 Identities = 10/21 (47%), Positives = 11/21 (52%) Frame = +1 Query: 385 CLFVVLTPXPPXXPPXPPPXP 447 C V+ P PP PP PP P Sbjct: 151 CRLTVVVPPPPLLPPVPPEPP 171 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 23.8 bits (49), Expect(2) = 5.7 Identities = 8/14 (57%), Positives = 8/14 (57%) Frame = +3 Query: 420 PPPPXXPPPXXXXG 461 PPPP PPP G Sbjct: 63 PPPPPPPPPQPPVG 76 Score = 23.4 bits (48), Expect(2) = 5.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +3 Query: 381 RMSVCSTYXXPXPPPPPXXPPP 446 R++ C + P PP P PPP Sbjct: 38 RLAKCPRFAPP-PPQPTLPPPP 58 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 24.2 bits (50), Expect(2) = 6.4 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +3 Query: 360 SIHVNKIRMSVCSTYXXPXPPPPPXXP 440 ++H++ + P PPPPP P Sbjct: 38 NLHIDDLLYGQHHALPHPPPPPPPPQP 64 Score = 23.0 bits (47), Expect(2) = 6.4 Identities = 7/9 (77%), Positives = 7/9 (77%) Frame = +3 Query: 417 PPPPPXXPP 443 PPPPP PP Sbjct: 86 PPPPPQKPP 94 >05_04_0011 + 17139322-17139451,17139552-17140174 Length = 250 Score = 25.4 bits (53), Expect(2) = 6.5 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 411 PXPPPPPXXPP 443 P PPPPP PP Sbjct: 171 PPPPPPPPSPP 181 Score = 21.8 bits (44), Expect(2) = 6.5 Identities = 8/17 (47%), Positives = 8/17 (47%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSG 467 PPPPP P G G Sbjct: 206 PPPPPSPPNGANVIGDG 222 >12_02_0326 + 17555731-17556387 Length = 218 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/24 (54%), Positives = 13/24 (54%) Frame = +1 Query: 376 KLECLFVVLTPXPPXXPPXPPPXP 447 KL C L P PP PP PPP P Sbjct: 194 KLYCAIQRLPP-PPALPPPPPPPP 216 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 28.7 bits (61), Expect = 7.0 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%) Frame = +1 Query: 400 LTPXPPXXPPXPPP-XPXXXXVPGARG 477 L P PP PP PPP P P RG Sbjct: 25 LPPPPPPHPPPPPPLEPAPPSTPQLRG 51 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 28.7 bits (61), Expect = 7.0 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 399 TYXXPXPPPPPXXPPPXXXXGSGGPGXXPLXRV 497 TY P PPPP PPP S P PL V Sbjct: 400 TYSSP-PPPPLYYPPPPDISPSPPPSVTPLPPV 431 >08_02_1256 + 25645085-25645396 Length = 103 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 378 IRMSVCSTYXXPXPPPPPXXPPP 446 + ++V S+ P PPPPP P P Sbjct: 51 LAIAVASSQQPPPPPPPPPLPSP 73 >08_02_0732 + 20521459-20522323,20522404-20522480,20523251-20523296, 20523482-20523713,20524244-20524439 Length = 471 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 387 SVCSTYXXPXPPPPPXXPPP 446 S+CST P PPPPP P Sbjct: 160 SLCSTSPAPAPPPPPAALDP 179 >08_01_0060 - 413088-413999 Length = 303 Score = 28.7 bits (61), Expect = 7.0 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +3 Query: 402 YXXPXPPPPPXXPPP 446 + P PPPPP PPP Sbjct: 26 FDQPPPPPPPPPPPP 40 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -1 Query: 484 GXIPGPPEPXXXXGGGXXGGGGGXG 410 G + P E GGG GGGGG G Sbjct: 381 GMLDKPDEAGGGGGGGSGGGGGGGG 405 >07_03_0111 + 13535912-13535972,13536081-13536142,13536418-13536510, 13537577-13537649,13537876-13538265,13538337-13538404, 13539334-13539375,13540211-13540735,13540817-13540974, 13541078-13541636,13542438-13542500,13542579-13542680, 13542779-13543096,13543175-13543267,13543489-13543590, 13543678-13543782,13544190-13544323,13545097-13545280, 13545701-13545832,13546215-13546327,13546468-13546558, 13547138-13549339 Length = 1889 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/40 (35%), Positives = 17/40 (42%) Frame = +3 Query: 366 HVNKIRMSVCSTYXXPXPPPPPXXPPPXXXXGSGGPGXXP 485 HV ++ V T PPPPP PPP + P P Sbjct: 107 HVRRLLDIVACTASFGPPPPPP--PPPSPKDAAADPAKEP 144 >07_01_0678 - 5103836-5104613,5104697-5104888,5104994-5105036, 5105712-5105835,5105924-5106016,5106754-5106931, 5107032-5107138,5108098-5108179,5108277-5108314, 5108409-5108495,5109025-5109135,5109282-5109773 Length = 774 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = +3 Query: 393 CSTYXXPXPPPPPXXPPPXXXXGSGGPG 476 C++ P PPPPP P G G G Sbjct: 95 CNSKPKPPPPPPPERPRRRAAAGGGAGG 122 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 28.7 bits (61), Expect = 7.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPG 476 P PPPPP PPP +G PG Sbjct: 228 PLPPPPP--PPPKPANIAGAPG 247 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 251 PPPPPPPPGPPP 262 Score = 28.3 bits (60), Expect = 9.3 Identities = 18/54 (33%), Positives = 21/54 (38%), Gaps = 3/54 (5%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGG--PGXXPLXRVNWXPN-MIKXFD*XWXXPTPKXP 563 P PPPPP PP G PG P+ + P I+ D P P P Sbjct: 404 PLPPPPPGLPPAQMQMAPFGVPPGPPPMLPPPFYPGPPIQTGDFAAFGPRPNVP 457 >04_04_0198 + 23502657-23502900,23505228-23505298,23505690-23505727, 23505905-23507693 Length = 713 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 406 PXPPXXPPXPPPXPXXXXVP 465 P PP PP PPP P P Sbjct: 549 PPPPPPPPPPPPAPAPALAP 568 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.7 bits (61), Expect = 7.0 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 3/34 (8%) Frame = +3 Query: 393 CSTYXXPXPPPPPXXPPP---XXXXGSGGPGXXP 485 C P PPP P PPP SGGP P Sbjct: 390 CGPAVPPPPPPTPPPPPPLLAPKQQSSGGPILPP 423 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 365 PPPPPPPPPPPP 376 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 366 PPPPPPPPPPPP 377 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 367 PPPPPPPPPPPP 378 >04_03_0874 + 20467608-20468306,20468575-20468736,20470083-20470160, 20470636-20470714,20470809-20470954,20471064-20471132, 20471262-20471430,20471526-20471776 Length = 550 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGG 470 P PPP P PPP G+ G Sbjct: 148 PPPPPAPPAPPPKPSSGNNG 167 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXP 485 P PPPPP PPP + P P Sbjct: 351 PPPPPPPPPPPPPPPKLNTAPKPPP 375 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/20 (50%), Positives = 10/20 (50%) Frame = +1 Query: 406 PXPPXXPPXPPPXPXXXXVP 465 P PP PP PPP P P Sbjct: 352 PPPPPPPPPPPPPPKLNTAP 371 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXP 485 P PPPPP PPP + P P Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPP 377 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPGXXP 485 P PPPPP PPP P P Sbjct: 354 PPPPPPPPPPPPKLNTAPKPPPPPP 378 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 349 PPPPPPPPPPPP 360 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 350 PPPPPPPPPPPP 361 >03_01_0023 + 198414-198968 Length = 184 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 466 PEPXXXXGGGXXGGGGGXG 410 P P GGG GGGGG G Sbjct: 33 PSPGGGGGGGGGGGGGGGG 51 >02_04_0083 + 19566476-19566539,19566781-19567006,19567206-19567389, 19569483-19569582,19570015-19570122,19570373-19570452, 19570566-19570644,19570774-19570832,19570938-19571006, 19571577-19571690,19571772-19571840,19572340-19572361, 19572455-19572522,19573630-19573715,19574220-19574349, 19575032-19575133,19575211-19575279 Length = 542 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 761 GGXGRSXXRAEKXPXPXPPPXTLETIKKER 672 GG GR+ + P PPP T +++ER Sbjct: 68 GGCGRAGDDLRRGPWMMPPPVTSSDVRRER 97 >02_01_0148 - 1051121-1051192,1051378-1051512,1052343-1052396, 1052501-1052581,1052667-1052826,1053346-1053453, 1053543-1053718,1053952-1054002,1054154-1054264, 1054493-1054547,1055667-1055789,1055922-1056007, 1056235-1056349,1056429-1056667 Length = 521 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGG 470 PPPPP P P G+GG Sbjct: 14 PPPPPSSPQPAAEVGAGG 31 >01_07_0079 - 40934918-40935301 Length = 127 Score = 28.7 bits (61), Expect = 7.0 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 478 IPGPPEPXXXXGGGXXGGGGGXG 410 + PP GGG GGGGG G Sbjct: 15 VENPPASANSGGGGGGGGGGGGG 37 >01_06_1107 + 34568091-34568341,34568455-34568540,34569204-34569292, 34569406-34569530,34569825-34569901,34570210-34570862 Length = 426 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/17 (58%), Positives = 10/17 (58%) Frame = +3 Query: 393 CSTYXXPXPPPPPXXPP 443 C TY PPPPP PP Sbjct: 239 CYTYTDHLPPPPPPQPP 255 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 28.7 bits (61), Expect = 7.0 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +3 Query: 384 MSVCSTYXXPXPPPPPXXPPPXXXXGSGGPGXXPLXRVNWXPNMIKXF 527 +SVC PPPPP PP G+ P RV P +++ + Sbjct: 281 LSVCGR--AAAPPPPPPPPPARRTSGAASPAASG-PRVTRVPEVVEFY 325 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 28.7 bits (61), Expect = 7.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = +1 Query: 394 VVLTPXPPXXPPXPPPXPXXXXVP 465 + + P PP PP PPP P P Sbjct: 70 IAVHPSPPPPPPPPPPPPPVPVPP 93 >01_01_0162 - 1394980-1395760,1396024-1396037 Length = 264 Score = 28.7 bits (61), Expect = 7.0 Identities = 16/51 (31%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 157 RKCPKGEHSVLY-----CPQMAEPDCENPEVHDFVDHVGPCDVPQCFCDRP 294 R+C +H +LY CP A HD H C CFC P Sbjct: 33 RRCVAVDH-ILYAITVPCPNAAHGCAARTPYHDSHGHAAGCPHAPCFCPEP 82 >01_01_0159 + 1380421-1381143 Length = 240 Score = 28.7 bits (61), Expect = 7.0 Identities = 16/51 (31%), Positives = 19/51 (37%), Gaps = 5/51 (9%) Frame = +1 Query: 157 RKCPKGEHSVLY-----CPQMAEPDCENPEVHDFVDHVGPCDVPQCFCDRP 294 R+C +H +LY CP A HD H C CFC P Sbjct: 9 RRCVAVDH-ILYAITVPCPNAAHGCAARTPYHDSHGHAAGCPHAPCFCPEP 58 >01_06_0264 + 28005997-28006823,28007107-28007290,28007603-28007701 Length = 369 Score = 25.4 bits (53), Expect(2) = 8.2 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 411 PXPPPPPXXPP 443 P PPPPP PP Sbjct: 4 PLPPPPPPRPP 14 Score = 21.4 bits (43), Expect(2) = 8.2 Identities = 9/23 (39%), Positives = 9/23 (39%) Frame = +3 Query: 417 PPPPPXXPPPXXXXGSGGPGXXP 485 PPPPP P GP P Sbjct: 7 PPPPPRPPLGRGRLVGVGPAPAP 29 >12_02_0896 + 24100015-24100240,24100910-24101277,24102144-24102380, 24102461-24102754 Length = 374 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/21 (57%), Positives = 12/21 (57%) Frame = -1 Query: 469 PPEPXXXXGGGXXGGGGGXGL 407 P E GGG GGGGG GL Sbjct: 9 PAERCLGRGGGGGGGGGGDGL 29 >12_01_0495 - 3935395-3937110 Length = 571 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 8 PLPPPPPPPPPP 19 >12_01_0373 + 2897874-2898911 Length = 345 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 387 SVCSTYXXPXPPPPPXXPPP 446 S+ +T PPPPP PPP Sbjct: 145 SILATVRPRRPPPPPPPPPP 164 >11_06_0208 - 21268722-21268763,21269146-21269274,21269388-21269537, 21270402-21270773 Length = 230 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 16 PGPPPPPPPPPP 27 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 85 PSPPPPPPPPPP 96 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 134 PLPPPPPTPPPP 145 >10_08_1013 - 22239396-22239536,22240629-22240715,22240787-22241131 Length = 190 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 13 PAPPPPPTPPPP 24 >10_08_0534 + 18595520-18595828,18595917-18597149 Length = 513 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 33 PSPPPPPPPPPP 44 >10_07_0053 - 12406958-12407011,12407012-12407168,12407280-12407410, 12407592-12407727,12407953-12408224,12408604-12408893, 12408984-12409285,12409359-12409424,12409506-12409571, 12409855-12409926,12410013-12410084,12410207-12410281, 12410367-12410438,12410531-12410663,12411556-12411655 Length = 665 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +3 Query: 369 VNKIRMSVCSTYXXPXPPPPPXXPPPXXXXGSGGPG 476 +N ++ S P PPPPP PP PG Sbjct: 215 INSLQTDGNSWSTGPAPPPPPFTAPPPSRNRKKSPG 250 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 338 PPPPPPPPPPPP 349 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 339 PPPPPPPPPPPP 350 >10_03_0021 + 7129786-7130117,7130227-7130347,7131048-7131136, 7131375-7131459,7131609-7131771,7132861-7132937, 7133016-7133160,7133236-7133537,7133615-7133720, 7134781-7134935,7135556-7135712,7135799-7135891, 7136232-7136359,7136439-7136696,7136855-7137145, 7137235-7137318,7138335-7138468,7138557-7138784, 7139778-7139958,7140021-7140108,7140268-7140434, 7140750-7141012,7141117-7141120 Length = 1216 Score = 28.3 bits (60), Expect = 9.3 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = +2 Query: 194 ALKWPSRTVRIPKSTISLTTWAHATYHSASATGLMS-GTRKL 316 A P+ +RIP S I W+ Y++ S +G M+ GT L Sbjct: 498 AFSLPNWILRIPYSFIEAVVWSCVVYYTVSVSGNMTVGTNIL 539 >09_06_0188 - 21441377-21442201 Length = 274 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -1 Query: 469 PPEPXXXXGGGXXGGGGGXG 410 PP GGG GGGGG G Sbjct: 192 PPSKKSRRGGGSGGGGGGGG 211 >09_06_0107 + 20907560-20908491,20908511-20908625,20908967-20909058, 20909293-20909556,20910714-20911494 Length = 727 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +1 Query: 394 VVLTPXPPXXPPXPPPXPXXXXVP 465 V P PP PP PPP P P Sbjct: 69 VSAAPPPPQTPPSPPPPPPPPPPP 92 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 82 PPPPPPPPPPPP 93 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 83 PPPPPPPPPPPP 94 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 84 PPPPPPPPPPPP 95 >09_04_0745 + 19884868-19886000,19886110-19886309,19886422-19886666, 19886880-19887668 Length = 788 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 264 PPPPPPPPPPPP 275 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 265 PPPPPPPPPPPP 276 >09_03_0130 - 12609417-12610462,12610786-12611040,12611139-12611253, 12611376-12611428,12611854-12612114,12612252-12612302, 12612412-12612660,12612779-12613007,12613292-12613666 Length = 877 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 12 PAPPPPPPPPPP 23 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 14 PPPPPPPPPPPP 25 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 15 PPPPPPPPPPPP 26 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 16 PPPPPPPPPPPP 27 >08_02_0796 - 21300251-21300373,21300846-21301721 Length = 332 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 103 PPPPPPPPPPPP 114 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 104 PPPPPPPPPPPP 115 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 105 PPPPPPPPPPPP 116 >07_03_1530 + 27502546-27502671,27503487-27503561,27504670-27504746, 27505576-27507522,27508478-27508946,27509898-27510079, 27510746-27511208,27511295-27511691,27511810-27511937, 27512106-27512273,27512452-27512559,27512830-27512838 Length = 1382 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 1157 PPPPPPPLPPPP 1168 >07_03_0154 + 14509979-14512033 Length = 684 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 53 PPPPPPPPPPPP 64 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 54 PPPPPPPPPPPP 65 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 55 PPPPPPPPPPPP 66 >07_01_0862 - 7172083-7172931 Length = 282 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 125 PAPPPPPPPPPP 136 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 43 PPPPPPPPPPPP 54 >06_03_0214 + 18067945-18068463,18068940-18069839,18069918-18070652 Length = 717 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 201 PLPPPPPPPPPP 212 >05_07_0066 + 27453611-27453627,27454729-27454872,27455998-27456690, 27457700-27458111,27458220-27458297,27458938-27458953, 27459038-27459192 Length = 504 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/29 (37%), Positives = 12/29 (41%) Frame = +3 Query: 399 TYXXPXPPPPPXXPPPXXXXGSGGPGXXP 485 T P PPP P PP + PG P Sbjct: 119 TRAPPPPPPAPAPAPPSSSSAAAAPGRSP 147 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 115 PSPPPPPPPPPP 126 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 117 PPPPPPPPPPPP 128 >05_01_0384 + 2997465-2999777,2999960-3000035,3003027-3003102, 3003571-3004442,3004592-3004773,3005206-3005295, 3005388-3005675,3005776-3005997,3006053-3006133, 3006634-3006861 Length = 1475 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 579 PPPPPPPPPPPP 590 >05_01_0380 + 2978256-2979284 Length = 342 Score = 28.3 bits (60), Expect = 9.3 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = +1 Query: 394 VVLTPXPPXXPPXPPPXP 447 V + P PP PP PPP P Sbjct: 23 VRMPPPPPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 30 PPPPPPPPPPPP 41 >05_01_0210 + 1583176-1584177 Length = 333 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 30 PLPPPPPPPPPP 41 >04_04_1027 - 30216859-30217212,30218769-30219178,30219395-30219800 Length = 389 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 24 PVPPPPPPPPPP 35 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 26 PPPPPPPPPPPP 37 >04_04_0360 - 24684159-24684565,24684654-24685089 Length = 280 Score = 28.3 bits (60), Expect = 9.3 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -3 Query: 485 RXXPRAPGTXXXXGXGGGXGGXXGGXGVS 399 R P G G GGG GG GG GVS Sbjct: 50 RSGPCYGGGGGGGGGGGGGGGGGGGSGVS 78 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 28.3 bits (60), Expect = 9.3 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = +3 Query: 411 PXPPPPPXXPPPXXXXGSGGPG 476 P PPPPP P P GG G Sbjct: 123 PEPPPPPPKPKPCECTYCGGHG 144 >04_01_0197 + 2323790-2324098,2324145-2324774 Length = 312 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 27 PPPPPPPPPPPP 38 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 28 PPPPPPPPPPPP 39 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 29 PPPPPPPPPPPP 40 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 30 PPPPPPPPPPPP 41 >04_01_0080 - 889548-889892 Length = 114 Score = 28.3 bits (60), Expect = 9.3 Identities = 6/20 (30%), Positives = 16/20 (80%) Frame = -1 Query: 364 IDLHNFINIQIPVHICQFSC 305 +D+H+++N+ + + +C+F C Sbjct: 84 VDIHDYLNLALHMQLCRFGC 103 >04_01_0034 - 401208-402923 Length = 571 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 322 PPPPPPPLDPPP 333 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 355 PPPPPPPPPPPP 366 >03_05_0269 - 22545925-22546554,22546663-22547010,22547447-22547797 Length = 442 Score = 28.3 bits (60), Expect = 9.3 Identities = 13/22 (59%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 472 GP-PEPXXXXGGGXXGGGGGXG 410 GP PE GGG GGGGG G Sbjct: 20 GPDPESGDGEGGGGGGGGGGGG 41 >03_02_0738 - 10824121-10825572 Length = 483 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 94 PPPPPPPSSPPP 105 >02_03_0279 + 17250347-17252098 Length = 583 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 124 PPPPPPPPPPPP 135 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 125 PPPPPPPPPPPP 136 >02_01_0674 + 5020118-5020202,5020301-5020436,5021075-5021140, 5021219-5021290,5021362-5021433,5024242-5024301, 5024494-5024565,5024655-5024720,5024798-5024863, 5024945-5025273,5025713-5025969,5026213-5026484, 5026580-5026715,5026833-5026972,5027051-5027207, 5027476-5027634 Length = 714 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 242 PAPPPPPFMPPP 253 >02_01_0062 - 448105-448145,448780-448866,449664-449790 Length = 84 Score = 28.3 bits (60), Expect = 9.3 Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 2/23 (8%) Frame = +3 Query: 411 PXPPPPPXXPP--PXXXXGSGGP 473 P PPPPP PP G GGP Sbjct: 18 PPPPPPPFFPPQWAPPVPGGGGP 40 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 422 PPPPPPPPPPPP 433 >01_06_0357 - 28668894-28669238,28669510-28669537,28669578-28669635, 28669836-28669916,28670395-28670526,28670609-28670926, 28672495-28673317 Length = 594 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 2 PPPPPPPPPPPP 13 >01_05_0490 + 22672241-22674679 Length = 812 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 695 PLPPPPPPPPPP 706 >01_01_0046 - 331758-332627 Length = 289 Score = 28.3 bits (60), Expect = 9.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = +3 Query: 411 PXPPPPPXXPPP 446 P PPPPP PPP Sbjct: 21 PPPPPPPPPPPP 32 >01_05_0292 + 20518668-20519090,20519213-20519281,20520204-20520473, 20520734-20521084,20521251-20521528,20522755-20523099, 20523346-20523911,20525155-20525528 Length = 891 Score = 25.8 bits (54), Expect(2) = 9.8 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 420 PPPPXXPPPXXXXGSG 467 PPPP PPP G G Sbjct: 57 PPPPPLPPPPPRSGRG 72 Score = 20.6 bits (41), Expect(2) = 9.8 Identities = 7/15 (46%), Positives = 7/15 (46%) Frame = +3 Query: 402 YXXPXPPPPPXXPPP 446 Y P PP PPP Sbjct: 46 YEKPLPPEDQLPPPP 60 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,821,169 Number of Sequences: 37544 Number of extensions: 525495 Number of successful extensions: 10749 Number of sequences better than 10.0: 127 Number of HSP's better than 10.0 without gapping: 3074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7789 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2682675460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -