BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M20 (875 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 23 2.8 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 23 2.8 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 23 2.8 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -2 Query: 343 LTFRFRYTFASFRVPDIRPVAEALWYVAWAHVVNEIVDFGILTV-RLGHLRAIQ 185 L F Y F PD P ++++ W VN ++ I T+ L + RA + Sbjct: 341 LPFFLMYVIVPF-CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFR 393 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -2 Query: 343 LTFRFRYTFASFRVPDIRPVAEALWYVAWAHVVNEIVDFGILTV-RLGHLRAIQ 185 L F Y F PD P ++++ W VN ++ I T+ L + RA + Sbjct: 341 LPFFLMYVIVPF-CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFR 393 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 23.4 bits (48), Expect = 2.8 Identities = 15/54 (27%), Positives = 24/54 (44%), Gaps = 1/54 (1%) Frame = -2 Query: 343 LTFRFRYTFASFRVPDIRPVAEALWYVAWAHVVNEIVDFGILTV-RLGHLRAIQ 185 L F Y F PD P ++++ W VN ++ I T+ L + RA + Sbjct: 341 LPFFLMYVIVPF-CPDCCPSDRMVYFITWLGYVNSALNPLIYTIFNLDYRRAFR 393 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,040 Number of Sequences: 438 Number of extensions: 3689 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 28402218 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -