BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M20 (875 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g38830.1 68415.m04771 tumor susceptibility protein-related co... 29 4.1 At5g46520.1 68418.m05728 disease resistance protein (TIR-NBS-LRR... 28 9.4 >At2g38830.1 68415.m04771 tumor susceptibility protein-related contains weak similarity to Swiss-Prot:Q99816 tumor susceptibility gene 101 protein [Homo sapiens] Length = 331 Score = 29.1 bits (62), Expect = 4.1 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +3 Query: 147 FQRENARKVNIQFCI--ALKWPSRTVRIPKSTISLTTWAHATY 269 F N KV + FC+ +L+ S T ++P T+ LT W H Y Sbjct: 58 FNHNNGAKVQL-FCLEGSLRIRSSTTQLP--TVQLTIWIHENY 97 >At5g46520.1 68418.m05728 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1298 Score = 27.9 bits (59), Expect = 9.4 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 359 DLHNFINIQIPVHICQFSC 303 ++HNF+ I+ +H+C F C Sbjct: 1077 EVHNFMEIEKGIHLCIFDC 1095 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,603,533 Number of Sequences: 28952 Number of extensions: 260832 Number of successful extensions: 627 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 611 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 627 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 2058178400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -