BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M18 (908 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60... 28 1.6 SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosacch... 28 1.6 SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9... 27 3.7 SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||M... 26 6.4 >SPAC12G12.04 |hsp60|hsp60|mitochondrial heat shock protein Hsp60|Schizosaccharomyces pombe|chr 1|||Manual Length = 582 Score = 28.3 bits (60), Expect = 1.6 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +2 Query: 374 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFIXSGVL 502 AK G ++ VGG ++ E EK + ++++ A A + GVL Sbjct: 402 AKLSGGIAVIKVGGSSEVEVNEKKDRIVDALNAVKAAVSEGVL 444 >SPAC22E12.04 |ccs1|pccs, pccs|metallochaperone Ccs1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -1 Query: 272 SRTASGCRTTERDRGPTAACGLEIL*RSSCCRSNKVLCC 156 S+ GC +TE+ T+ C E + SCC S K CC Sbjct: 257 SQEKKGCCSTEK----TSCCSQE---KKSCCTSEKPSCC 288 >SPAC589.02c |med13|spTrap240, srb9|mediator complex subunit Srb9|Schizosaccharomyces pombe|chr 1|||Manual Length = 1223 Score = 27.1 bits (57), Expect = 3.7 Identities = 17/61 (27%), Positives = 25/61 (40%) Frame = +2 Query: 218 LPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTV 397 +P+ D T L GY + D L L+ +L I R HD Y + + Y + Sbjct: 1125 MPVPNDEFKKISTILARGYLALDEDESYLPLLSIHLLISRNHDPYLMLNLILKHYLSMIY 1184 Query: 398 L 400 L Sbjct: 1185 L 1185 >SPBC887.12 |||P-type ATPase |Schizosaccharomyces pombe|chr 2|||Manual Length = 1258 Score = 26.2 bits (55), Expect = 6.4 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -3 Query: 513 CSANSTPEXMKAVRACCDSSRRLYFSGS 430 C NST + M V C D RLY G+ Sbjct: 652 CEFNSTRKRMSIVFRCPDGKIRLYVKGA 679 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,077,030 Number of Sequences: 5004 Number of extensions: 53510 Number of successful extensions: 108 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 105 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 460503700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -