BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M18 (908 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein si... 52 7e-07 At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein si... 50 2e-06 At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein si... 47 2e-05 At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein si... 46 3e-05 At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein si... 46 5e-05 At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein si... 41 0.001 At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein si... 39 0.005 At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein si... 38 0.007 At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein si... 33 0.20 At1g61810.1 68414.m06972 glycosyl hydrolase family 1 protein con... 30 2.4 At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi... 29 4.3 At2g33210.1 68415.m04069 chaperonin, putative similar to SWISS-P... 29 5.6 >At4g19800.1 68417.m02904 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 398 Score = 51.6 bits (118), Expect = 7e-07 Identities = 30/111 (27%), Positives = 58/111 (52%), Gaps = 1/111 (0%) Frame = +2 Query: 227 DLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAIT-SLKAKYPGLTVLL 403 D+D +L THL +A ++ ++Y++ N + A T +++ + P + LL Sbjct: 22 DIDSSLF--THLFCTFADLEAESYEITIATWN------QAPFHAFTETVQQRNPHVKTLL 73 Query: 404 SVGGDADTEEPEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFPR 556 S+GG + + + + + +R +FI S + +A YGF G+D W++PR Sbjct: 74 SIGGG--NADKDAFASMASNPDSRASFIQSTITVARSYGFHGLDLDWEYPR 122 >At4g19720.1 68417.m02896 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 363 Score = 50.4 bits (115), Expect = 2e-06 Identities = 29/101 (28%), Positives = 50/101 (49%) Frame = +2 Query: 254 THLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLSVGGDADTEE 433 THL +A + P T +V + ++ N+ I +K K P + LLS+GG + Sbjct: 39 THLFCAFADLDPQTNSVVVSGAH---EQEFSNFTKI--VKKKNPHVQTLLSIGGR--NAD 91 Query: 434 PEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFPR 556 + + + +R +FI S + A Y FDG+D W++P+ Sbjct: 92 KSAFASMASNPTSRKSFIWSAISSARYYRFDGLDLVWKYPK 132 >At4g19810.1 68417.m02905 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 379 Score = 46.8 bits (106), Expect = 2e-05 Identities = 29/109 (26%), Positives = 52/109 (47%) Frame = +2 Query: 227 DLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLS 406 D+D +L THL +A + T ++ + N T +++ + P + LLS Sbjct: 43 DIDSSLF--THLFCAFADLNSQTNQVTVSSANQPKFSTFTQ-----TVQRRNPSVKTLLS 95 Query: 407 VGGDADTEEPEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFP 553 +GG + Y + + +R +FI S + +A YGF G+D W++P Sbjct: 96 IGGGI--ADKTAYASMASNPTSRKSFIDSSIRVARSYGFHGLDLDWEYP 142 >At4g19820.1 68417.m02906 glycosyl hydrolase family 18 protein similar to chitinase/lysozyme GI:467689 from [Nicotiana tabacum] Length = 366 Score = 46.4 bits (105), Expect = 3e-05 Identities = 29/105 (27%), Positives = 49/105 (46%) Frame = +2 Query: 245 SFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAKYPGLTVLLSVGGDAD 424 S THL +A I TY+++ + N T +++ + P + LLS+GGD Sbjct: 45 SLFTHLFCAFADINTLTYQVIVSSRNKPKFSTFTQ-----TVRRRNPTVKTLLSIGGDFT 99 Query: 425 TEEPEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFPRV 559 + + + +R FI S + LA GF G+D W++P + Sbjct: 100 YNFA--FASMASNPTSRKLFISSSIKLARSCGFHGLDLNWKYPSI 142 >At4g19730.1 68417.m02897 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 332 Score = 45.6 bits (103), Expect = 5e-05 Identities = 30/118 (25%), Positives = 55/118 (46%) Frame = +2 Query: 200 ESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITSLKAK 379 E+Q + + P+ F THL +A + +++K+ + I T ++K + Sbjct: 24 ETQDPITSAETIPSALF-THLFCAFADLDANSHKVFVSQAHEFIFSTFTE-----TVKIR 77 Query: 380 YPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFP 553 P + LLS+GG + + + Q+R FI S + +A GF G+D W++P Sbjct: 78 NPQVKTLLSIGGK--NANNSAFASMASNHQSRKTFIDSWIFIARSNGFHGLDLAWEYP 133 >At4g19770.1 68417.m02901 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 261 Score = 41.1 bits (92), Expect = 0.001 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +2 Query: 452 LLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFPR 556 + S R +FI S + +A YGFDG+D W++PR Sbjct: 1 MASSSYGRKSFILSTISIARSYGFDGLDLDWEYPR 35 >At4g19760.1 68417.m02900 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:505267 from [Nicotiana tabacum] Length = 365 Score = 38.7 bits (86), Expect = 0.005 Identities = 31/125 (24%), Positives = 57/125 (45%) Frame = +2 Query: 179 DSRSXVRESQARMLPLDLDPALSFCTHLLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRA 358 D +S E ++ P + F THL +A + T+++ N ++ Sbjct: 22 DGKSQSPECLSQGTPSSFIDSTLF-THLFCAFADVDSSTHEVTISAAN-----SYQFSSF 75 Query: 359 ITSLKAKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDX 538 ++K K + LLS+GG D ++ ++ S+ R AFI S + +A + F G+D Sbjct: 76 TETVKEKNTDVQTLLSIGGK-DADKAVLASMASNSKN-RKAFIDSSIDIARKKDFYGLDL 133 Query: 539 XWQFP 553 W++P Sbjct: 134 AWEYP 138 >At4g19750.1 68417.m02899 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 362 Score = 38.3 bits (85), Expect = 0.007 Identities = 28/102 (27%), Positives = 51/102 (50%), Gaps = 2/102 (1%) Frame = +2 Query: 254 THLLYGYAGIQPDTYKL-VSLNENLDIDR-THDNYRAITSLKAKYPGLTVLLSVGGDADT 427 THL +A + T+++ +S + + TH ++K K + LLS+GG D Sbjct: 38 THLFCAFADVDSSTHEVTISAANSCQVSSFTH-------TVKDKNTDVQTLLSIGGK-DA 89 Query: 428 EEPEKYNLLLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFP 553 ++ ++ S+ R AFI S + +A + F G+D W++P Sbjct: 90 DKAVLASMASNSKN-RKAFIDSSIDIARKKDFYGLDLAWEYP 130 >At4g19740.1 68417.m02898 glycosyl hydrolase family 18 protein similar to chitinase, class V GI:899342 from [Nicotiana tabacum] Length = 289 Score = 33.5 bits (73), Expect = 0.20 Identities = 11/34 (32%), Positives = 22/34 (64%) Frame = +2 Query: 452 LLESQQARTAFIXSGVLLAEQYGFDGIDXXWQFP 553 ++ ++ +R +FI S + +A GF G+D W++P Sbjct: 79 IVSNRTSRESFISSSISIARSLGFYGLDLAWEYP 112 >At1g61810.1 68414.m06972 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to beta-glucosidase (GI:3820531) [Pinus contorta]; similar to beta-glucosidase GI:804655 from (Hordeum vulgare) Length = 520 Score = 29.9 bits (64), Expect = 2.4 Identities = 23/86 (26%), Positives = 44/86 (51%), Gaps = 4/86 (4%) Frame = +2 Query: 269 GYAGIQPDTYKLVSLNENLDIDRTHDN----YRAITSLKAKYPGLTVLLSVGGDADTEEP 436 GYA ++ D V++ E D++ H + ++ + LK +YP + + ++ G D ++P Sbjct: 368 GYA-LKLDRKGNVTIGELTDVNWQHIDPTGFHKMLNYLKDRYPNMPMFITENGFGDLQKP 426 Query: 437 EKYNLLLESQQARTAFIXSGVLLAEQ 514 E + L + R ++ SG L A Q Sbjct: 427 ETTDKELLNDTKRIQYM-SGYLEALQ 451 >At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 551 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 260 LLYGYAGIQPDTYKLVSLNENLDIDRTHDNYRAITS 367 LLYGY+G+ +KL L+ +RT ++ A+ S Sbjct: 130 LLYGYSGMAEHAHKLFDEMPELNCERTVKSFNALLS 165 >At2g33210.1 68415.m04069 chaperonin, putative similar to SWISS-PROT:Q05046- chaperonin CPN60-2, mitochondrial precursor (HSP60-2) [Cucurbita maxima]; contains Pfam:PF00118 domain, TCP-1/cpn60 chaperonin family Length = 585 Score = 28.7 bits (61), Expect = 5.6 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 374 AKYPGLTVLLSVGGDADTEEPEKYNLLLESQQARTAFIXSGVL 502 AK G +L +GG ++TE EK + + ++ A A + G++ Sbjct: 401 AKLSGGVAVLKIGGASETEVSEKKDRVTDALNATKAAVEEGIV 443 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,750,274 Number of Sequences: 28952 Number of extensions: 308296 Number of successful extensions: 633 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 631 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2149324008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -