BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M13 (782 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g59910.1 68414.m06749 formin homology 2 domain-containing pro... 45 5e-05 At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family... 42 3e-04 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 42 5e-04 At3g15000.1 68416.m01897 expressed protein similar to DAG protei... 39 0.003 At1g61080.1 68414.m06877 proline-rich family protein 39 0.004 At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family... 38 0.006 At4g13340.1 68417.m02084 leucine-rich repeat family protein / ex... 36 0.023 At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family... 36 0.040 At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associa... 35 0.053 At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associa... 35 0.053 At5g54650.2 68418.m06805 formin homology 2 domain-containing pro... 35 0.070 At5g54650.1 68418.m06804 formin homology 2 domain-containing pro... 35 0.070 At2g04170.1 68415.m00402 meprin and TRAF homology domain-contain... 35 0.070 At3g44340.1 68416.m04764 sec23/sec24 transport family protein co... 34 0.092 At2g04190.1 68415.m00404 meprin and TRAF homology domain-contain... 34 0.092 At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associa... 34 0.12 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 34 0.12 At1g15830.1 68414.m01900 expressed protein 34 0.12 At3g22800.1 68416.m02874 leucine-rich repeat family protein / ex... 33 0.21 At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family... 33 0.21 At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protei... 32 0.37 At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protei... 32 0.37 At4g16140.1 68417.m02445 proline-rich family protein contains pr... 31 0.65 At3g22070.1 68416.m02785 proline-rich family protein contains pr... 31 0.65 At1g26250.1 68414.m03202 proline-rich extensin, putative similar... 31 0.65 At5g45350.1 68418.m05567 proline-rich family protein contains pr... 31 0.86 At5g19810.1 68418.m02354 proline-rich extensin-like family prote... 31 0.86 At5g07780.1 68418.m00890 formin homology 2 domain-containing pro... 31 0.86 At3g18810.1 68416.m02389 protein kinase family protein contains ... 31 0.86 At1g26240.1 68414.m03201 proline-rich extensin-like family prote... 31 0.86 At5g19090.1 68418.m02269 heavy-metal-associated domain-containin... 31 1.1 At5g23150.1 68418.m02707 PWWP domain-containing protein identica... 30 1.5 At1g24150.1 68414.m03047 formin homology 2 domain-containing pro... 30 1.5 At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family... 30 1.5 At5g07770.1 68418.m00889 formin homology 2 domain-containing pro... 29 1.8 At3g08530.1 68416.m00990 clathrin heavy chain, putative similar ... 30 2.0 At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid t... 30 2.0 At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid t... 30 2.0 At1g49750.1 68414.m05579 leucine-rich repeat family protein cont... 30 2.0 At5g26080.1 68418.m03103 proline-rich family protein contains pr... 29 2.6 At4g18570.1 68417.m02749 proline-rich family protein common fami... 29 2.6 At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family... 29 2.6 At1g62440.1 68414.m07044 leucine-rich repeat family protein / ex... 29 2.6 At1g53260.1 68414.m06035 hypothetical protein low similarity to ... 29 2.6 At1g31750.1 68414.m03895 proline-rich family protein contains pr... 29 2.6 At1g21310.1 68414.m02662 proline-rich extensin-like family prote... 29 2.6 At5g11990.1 68418.m01402 proline-rich family protein contains pr... 29 3.5 At4g03120.1 68417.m00425 proline-rich family protein similar to ... 29 3.5 At1g54215.1 68414.m06180 proline-rich family protein contains pr... 26 3.5 At5g62640.1 68418.m07862 proline-rich family protein contains pr... 29 4.6 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 29 4.6 At4g18670.1 68417.m02762 leucine-rich repeat family protein / ex... 29 4.6 At3g20850.1 68416.m02636 proline-rich family protein contains pr... 29 4.6 At2g18470.1 68415.m02151 protein kinase family protein contains ... 29 4.6 At1g24490.1 68414.m03084 60 kDa inner membrane family protein si... 29 4.6 At4g33970.1 68417.m04820 leucine-rich repeat family protein / ex... 28 6.1 At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 fam... 28 6.1 At3g10300.3 68416.m01236 calcium-binding EF hand family protein ... 28 6.1 At3g10300.2 68416.m01235 calcium-binding EF hand family protein ... 28 6.1 At3g10300.1 68416.m01234 calcium-binding EF hand family protein ... 28 6.1 At3g06130.1 68416.m00704 heavy-metal-associated domain-containin... 28 6.1 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 28 6.1 At1g15840.1 68414.m01901 expressed protein 28 6.1 At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family... 28 6.1 At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid t... 28 8.0 At3g11130.1 68416.m01349 clathrin heavy chain, putative similar ... 28 8.0 >At1g59910.1 68414.m06749 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02128 Length = 929 Score = 45.2 bits (102), Expect = 5e-05 Identities = 21/56 (37%), Positives = 21/56 (37%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGG 671 PPPP PPP G PPPP G G PPP PP G G Sbjct: 386 PPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKG 441 Score = 33.9 bits (74), Expect = 0.12 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 P PP PPP PPPPK PPP Sbjct: 373 PAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPP 412 Score = 31.9 bits (69), Expect = 0.49 Identities = 18/54 (33%), Positives = 18/54 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXG 665 PP P PPP PPPP G PPP PP G G Sbjct: 372 PPAPPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPP-----PPPGKKGAG 420 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/51 (33%), Positives = 17/51 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXG 656 PPPP PPP G G PPPP P P P G Sbjct: 397 PPPPPKKGPAAPPPPPPPGKKGAG-PPPPPPMSKKGPPKPPGNPKGPTKSG 446 Score = 31.1 bits (67), Expect = 0.86 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 1/58 (1%) Frame = -3 Query: 606 PPPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPGXPXXXXKKXGVXPE-NPGG 436 PPP PP P G PP G G P P KK P NP G Sbjct: 384 PPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKGAGPPPPPPMSKKGPPKPPGNPKG 441 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +3 Query: 543 PPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGGG 674 PP PPPP PPPK PP G G Sbjct: 375 PPGPANQTSPPPPPPPSAAAPPPPPPPKKGPAAPPPPPPPGKKG 418 >At3g25690.1 68416.m03197 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At4g04980, At5g61090 [Arabidopsis thaliana]; identical to cDNA CHUP1 for actin binding protein GI:28071264 Length = 1004 Score = 42.3 bits (95), Expect = 3e-04 Identities = 23/64 (35%), Positives = 24/64 (37%), Gaps = 3/64 (4%) Frame = +2 Query: 491 PGXXPXPPXX---GGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXGX 661 P P PP GG P + G PPPP GGG PP PPP G Sbjct: 648 PPRVPRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPPPPPPPPGA 707 Query: 662 XGGG 673 G G Sbjct: 708 LGRG 711 Score = 35.9 bits (79), Expect = 0.030 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPP 597 PPP P GGG GG PPPPP Sbjct: 679 PPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 35.5 bits (78), Expect = 0.040 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -1 Query: 620 GGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXP 522 GG PPPPP GGG PPP GGG P Sbjct: 676 GGGPPPPPPPPGGG-----PPPPPGGGPPPPPP 703 Score = 33.9 bits (74), Expect = 0.12 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = -2 Query: 673 PPPPXPPXXGGXXXXVXGGGXXPPPXFXGGGG 578 PPPP PP GG GGG PPP G G Sbjct: 679 PPPPPPPPGGGPPPP-PGGGPPPPPPPPGALG 709 Score = 33.1 bits (72), Expect = 0.21 Identities = 26/75 (34%), Positives = 28/75 (37%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXP 492 PPP + GGG PP P GGG PPP GGG P GG P Sbjct: 654 PPPRSA--GGGKSTNLPSARPPLP----GGGPP--PPPPPPGGGPP---PPPGGGPPPPP 702 Query: 491 GPPXXXKKXXGFXRK 447 PP + G K Sbjct: 703 PPPGALGRGAGGGNK 717 Score = 31.9 bits (69), Expect = 0.49 Identities = 17/42 (40%), Positives = 17/42 (40%) Frame = +1 Query: 487 GPGXKXXPPXLXGXXFXSPPPXGGGWXXPXXPPPXKXGGGGG 612 G G PP G PPP GG P PPP G G G Sbjct: 676 GGGPPPPPPPPGG----GPPPPPGGGPPPPPPPPGALGRGAG 713 Score = 31.1 bits (67), Expect = 0.86 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 681 GTNPPPXXPXXGGGXXXXFXGGXXXPPP 598 G PPP P GGG GG PPP Sbjct: 676 GGGPPPPPPPPGGGPPPPPGGGPPPPPP 703 Score = 30.7 bits (66), Expect = 1.1 Identities = 19/48 (39%), Positives = 20/48 (41%), Gaps = 5/48 (10%) Frame = -1 Query: 611 PPPPPXFXGGGXXGXX---QPPPXGGGXXKXXPXXXGGXXFXP--GPP 483 P PPP GGG +PP GGG P GG P GPP Sbjct: 652 PRPPPRSAGGGKSTNLPSARPPLPGGGPPPPPPPPGGGPPPPPGGGPP 699 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 41.9 bits (94), Expect = 5e-04 Identities = 25/64 (39%), Positives = 26/64 (40%) Frame = -2 Query: 673 PPPPXPPXXGGXXXXVXGGGXXPPPXFXGGGGXXXPXNPXXXGGGXKXXXPXXGGGGXXX 494 PP P PP GG GGG PP GG G P GGG GGGG Sbjct: 35 PPVPKPPQHGGG-----GGGGSKPPPHHGGKGGGKPPPHGGKGGGPPH---HGGGGGGGG 86 Query: 493 RXPP 482 + PP Sbjct: 87 KSPP 90 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/50 (40%), Positives = 20/50 (40%), Gaps = 1/50 (2%) Frame = +2 Query: 527 PXFXPPPXXXGVGGXXXPPPPXKXG-GGXXXPPXNXXXXPPPXXGXXGGG 673 P PP G GG PPP G GG PP PP G GGG Sbjct: 35 PPVPKPPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGG 84 Score = 39.5 bits (88), Expect = 0.002 Identities = 20/46 (43%), Positives = 20/46 (43%), Gaps = 1/46 (2%) Frame = +3 Query: 540 PPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXX-PPXXGGXGGGG 674 PP G G PPP GG PPP PP GG GGGG Sbjct: 40 PPQHGGGGGGGSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGG 85 Score = 37.9 bits (84), Expect = 0.008 Identities = 21/55 (38%), Positives = 21/55 (38%) Frame = +1 Query: 484 GGPGXKXXPPXLXGXXFXSPPPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPP 648 GG G PP G PPP GG PP GGGGG PPP Sbjct: 46 GGGGGSKPPPHHGGKGGGKPPPHGG----KGGGPPHHGGGGGGGGKSPPVVRPPP 96 Score = 31.9 bits (69), Expect = 0.49 Identities = 15/40 (37%), Positives = 16/40 (40%) Frame = -3 Query: 681 GTNPPPXXPXXGGGXXXXFXGGXXXPPPXFXGGGGXXXPP 562 G+ PPP GGG G PP GGGG P Sbjct: 50 GSKPPPHHGGKGGGKPPPHGGKGGGPPHHGGGGGGGGKSP 89 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/38 (39%), Positives = 16/38 (42%) Frame = +1 Query: 508 PPXLXGXXFXSPPPXGGGWXXPXXPPPXKXGGGGGXPP 621 PP + PPP G P PP GGGGG P Sbjct: 175 PPIINPPPVTVPPPSSG--YPPYGPPSGGGGGGGGKQP 210 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/58 (34%), Positives = 21/58 (36%), Gaps = 2/58 (3%) Frame = +3 Query: 507 PPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXX--PPXXGGXGGGG 674 PP L P GL PPP PPP + PP GG GGGG Sbjct: 155 PPVTTPPGLLPPVTTPPGLLPPIINPPPVTV-----PPPSSGYPPYGPPSGGGGGGGG 207 >At3g15000.1 68416.m01897 expressed protein similar to DAG protein (required for chloroplast differentiation and palisade development) GB:Q38732 [Antirrhinum majus] Length = 395 Score = 39.1 bits (87), Expect = 0.003 Identities = 22/58 (37%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +2 Query: 494 GXXPXPPXXGGPXFXPPPXXXGVGGXXXPPP---PXKXGGGXXXPPXNXXXXPPPXXG 658 G P PP G + PPP +GG PPP P + G PP N PPP G Sbjct: 269 GSAPPPPHMG-QNYGPPP-PNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYG 324 Score = 36.3 bits (80), Expect = 0.023 Identities = 20/60 (33%), Positives = 20/60 (33%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXP 492 PPP P GG GG PPPP G PP G P GG P Sbjct: 241 PPPQRPPMGGPPPPPHIGGSAPPPPHMGGSA----PPPPHMGQNYGPPPPNNMGGPRHPP 296 Score = 35.1 bits (77), Expect = 0.053 Identities = 22/59 (37%), Positives = 23/59 (38%) Frame = +2 Query: 494 GXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXGXXGG 670 G P P GGP PPP +GG PPP GG PP PP GG Sbjct: 240 GPPPQRPPMGGPP--PPPH---IGGSAPPPP--HMGGSAPPPPHMGQNYGPPPPNNMGG 291 Score = 35.1 bits (77), Expect = 0.053 Identities = 18/40 (45%), Positives = 18/40 (45%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PPPP G PPP G PPPP GG PPP Sbjct: 262 PPPPHMGGSA--PPPPHMGQN--YGPPPPNNMGGPRHPPP 297 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +3 Query: 510 PPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGG 668 PP + PPP G PPPP G PP PP GG Sbjct: 241 PPPQRPPMGGPPPPPH--IGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGG 291 Score = 31.9 bits (69), Expect = 0.49 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = +2 Query: 494 GXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXP--PPXXG 658 G P PP GG PPP +GG PPP G PP N P PP G Sbjct: 249 GGPPPPPHIGGSA--PPPPH--MGGS--APPPPHMGQNYGPPPPNNMGGPRHPPPYG 299 Score = 31.9 bits (69), Expect = 0.49 Identities = 19/58 (32%), Positives = 19/58 (32%), Gaps = 6/58 (10%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGG------GXXXPPXNXXXXPPPXXG 658 P P GGP PP P PP GG G P N PPP G Sbjct: 284 PPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYG 341 Score = 31.5 bits (68), Expect = 0.65 Identities = 27/102 (26%), Positives = 29/102 (28%), Gaps = 6/102 (5%) Frame = -2 Query: 673 PPPPXPPXXGGXXXXVXGGGXXPPPXFXGGGGXXXP------XNPXXXGGGXKXXXPXXG 512 PPP PP GG GG PPP GG P P G P G Sbjct: 241 PPPQRPP-MGGPPPPPHIGGSAPPPPHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYG 299 Query: 511 GGGXXXRXPPKXXKKXXGXPGKPXGXXFFKXPRGGKTXPQXG 386 P+ + G P G GG P G Sbjct: 300 APPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPPPNYG 341 Score = 29.9 bits (64), Expect = 2.0 Identities = 29/88 (32%), Positives = 31/88 (35%), Gaps = 6/88 (6%) Frame = -3 Query: 681 GTNPPPXXPXXGGGXXXX-FXGGXXXPPPXFXGGGGXXXPP---TPXXXGGGXKXGPPQX 514 G+ PPP P GG G PPP GG PP P GG + PPQ Sbjct: 259 GSAPPP--PHMGGSAPPPPHMGQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPR--PPQN 314 Query: 513 GGXGFXP--GXPXXXXKKXGVXPENPGG 436 G P G G P N GG Sbjct: 315 YGGTPPPNYGGAPPANNMGGAPPPNYGG 342 Score = 28.3 bits (60), Expect = 6.1 Identities = 19/66 (28%), Positives = 20/66 (30%), Gaps = 6/66 (9%) Frame = +3 Query: 486 GXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGG------GXXPPPKTXXXXPP 647 G PPP G PP P PP+ GG G PP PP Sbjct: 278 GQNYGPPPPNNMGGPRHPPPYGAPPQNNMGGPRPPQNYGGTPPPNYGGAPPANNMGGAPP 337 Query: 648 XXGGXG 665 G G Sbjct: 338 PNYGGG 343 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/45 (37%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 538 SPPPXGGGWXXPXXPPPXKXGGG-----GGXPPXKXXXXPPPXXG 657 +PPP GG PP GG GG PP + PPP G Sbjct: 318 TPPPNYGG-----APPANNMGGAPPPNYGGGPPPQYGAVPPPQYG 357 Score = 27.9 bits (59), Expect = 8.0 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 540 PPPXXXGLX---GXXXPPPPKXXGGGXXPPPKTXXXXPPXXGG 659 PPP G PPP GG PPP+ PP GG Sbjct: 319 PPPNYGGAPPANNMGGAPPPNYGGG---PPPQYGAVPPPQYGG 358 >At1g61080.1 68414.m06877 proline-rich family protein Length = 907 Score = 38.7 bits (86), Expect = 0.004 Identities = 19/58 (32%), Positives = 19/58 (32%) Frame = +3 Query: 450 PGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 P P F G PPPP PPP PPPP G PPP Sbjct: 494 PPTPPAFKPLKGSAPPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPP 551 Score = 36.7 bits (81), Expect = 0.017 Identities = 20/64 (31%), Positives = 21/64 (32%), Gaps = 7/64 (10%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP-------KTXXXXPPXXGGX 662 PPPP PPP G PPPP PPP + P G Sbjct: 526 PPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNS 585 Query: 663 GGGG 674 G GG Sbjct: 586 GSGG 589 Score = 35.5 bits (78), Expect = 0.040 Identities = 17/44 (38%), Positives = 18/44 (40%), Gaps = 4/44 (9%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXG----GGXXPPP 623 PPPP G PPP + PPP G GG PPP Sbjct: 551 PPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPMGNSGSGGPPPPP 594 Score = 35.5 bits (78), Expect = 0.040 Identities = 21/60 (35%), Positives = 21/60 (35%), Gaps = 3/60 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXX---XPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGGG 674 PPPP PPP G G PPPP G PPP PP G G Sbjct: 565 PPPPPMQNRAPSPPPMPMGNSGSGGPPPPPPPMPLANGATPPP----PPPPMAMANGAAG 620 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P P P PPP V PPPP PP PP Sbjct: 511 PPPPPLPTTIAAPPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPP 563 Score = 31.1 bits (67), Expect = 0.86 Identities = 21/69 (30%), Positives = 21/69 (30%), Gaps = 5/69 (7%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPP----XNXXXXPPP-XX 655 P P PP PPP PPPP PP N PPP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPPPPPPMQNRAPSPPPMPM 582 Query: 656 GXXGGGFVP 682 G G G P Sbjct: 583 GNSGSGGPP 591 Score = 31.1 bits (67), Expect = 0.86 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGG 543 PPP P G PPPPP G G PPP G Sbjct: 593 PPPPMPLANGATPP------PPPPPMAMANGAAGPPPPPPRMG 629 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/51 (35%), Positives = 18/51 (35%) Frame = -1 Query: 674 TPPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXP 522 TPPP P G PPPPP G G PPP G P Sbjct: 604 TPPPPPPPMAMANGA---AGPPPPPPRM--GMANGAAGPPPPPGAARSLRP 649 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/56 (35%), Positives = 20/56 (35%), Gaps = 2/56 (3%) Frame = +2 Query: 521 GGPXFXPPPXXXGVGGXX--XPPPPXKXGGGXXXPPXNXXXXPPPXXGXXGGGFVP 682 GGP PPP G PPPP G PP PPP G G P Sbjct: 588 GGPPPPPPPMPLA-NGATPPPPPPPMAMANGAAGPP-----PPPPRMGMANGAAGP 637 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/52 (32%), Positives = 18/52 (34%), Gaps = 5/52 (9%) Frame = +3 Query: 483 GGXRXKXPPPPXXGXXLXXPPPXXXGL-XGXXXPPPPK----XXGGGXXPPP 623 GG PP P PPP + G PPPP G PPP Sbjct: 588 GGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPP 639 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/43 (32%), Positives = 14/43 (32%) Frame = -1 Query: 611 PPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXPGPP 483 PPPPP PPP G P G P PP Sbjct: 523 PPPPPPPPRAAVAPPPPPPPPGTAAAPPPPPPPPGTQAAPPPP 565 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/56 (32%), Positives = 18/56 (32%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXG 658 P P P G PPP G PPPP G N PPP G Sbjct: 592 PPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMG-----MANGAAGPPPPPG 642 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/53 (33%), Positives = 19/53 (35%), Gaps = 4/53 (7%) Frame = +3 Query: 444 GFPGKPXXFFXXXGGXRXKXPPPPXX---GXXLXXPPPXXXGL-XGXXXPPPP 590 G P P G PPPP G PPP G+ G PPPP Sbjct: 588 GGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMANGAAGPPPP 640 Score = 27.9 bits (59), Expect = 8.0 Identities = 21/67 (31%), Positives = 21/67 (31%), Gaps = 5/67 (7%) Frame = -1 Query: 668 PPXTPXXGGGXXXXFXGGXPPPPPXF-XGGGXXGXXQPPP----XGGGXXKXXPXXXGGX 504 PP P G GG PPPPP G PPP G P G Sbjct: 577 PPPMPMGNSGS-----GGPPPPPPPMPLANGATPPPPPPPMAMANGAAGPPPPPPRMGMA 631 Query: 503 XFXPGPP 483 GPP Sbjct: 632 NGAAGPP 638 >At5g49280.1 68418.m06099 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 162 Score = 38.3 bits (85), Expect = 0.006 Identities = 24/77 (31%), Positives = 24/77 (31%) Frame = -2 Query: 673 PPPPXPPXXGGXXXXVXGGGXXPPPXFXGGGGXXXPXNPXXXGGGXKXXXPXXGGGGXXX 494 PPPP PP P P GGG P GGG K P GGG Sbjct: 50 PPPPSPPPPSTPTTACP---PPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGYY 106 Query: 493 RXPPKXXKKXXGXPGKP 443 PP P P Sbjct: 107 YPPPYSGNYPTPPPPNP 123 Score = 36.7 bits (81), Expect = 0.017 Identities = 22/54 (40%), Positives = 23/54 (42%), Gaps = 5/54 (9%) Frame = +2 Query: 503 PXPPXXGG--PXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPP---XNXXXXPPP 649 P PP GG + PPP G GG PPP G G PP N PPP Sbjct: 69 PSPPSSGGGSSYYYPPPSQSG-GGSKYPPPYGGGGQGYYYPPPYSGNYPTPPPP 121 Score = 35.1 bits (77), Expect = 0.053 Identities = 21/64 (32%), Positives = 23/64 (35%) Frame = -1 Query: 674 TPPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFX 495 +PPP +P PPP P GGG PP GG K P GG Sbjct: 49 SPPPPSPPPPSTPTTACP---PPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQGY 105 Query: 494 PGPP 483 PP Sbjct: 106 YYPP 109 Score = 33.9 bits (74), Expect = 0.12 Identities = 18/47 (38%), Positives = 18/47 (38%) Frame = +3 Query: 483 GGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 GG PPP G PPP G G PPP G PPP Sbjct: 76 GGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPP--YSGNYPTPPP 120 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/43 (37%), Positives = 17/43 (39%), Gaps = 3/43 (6%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPP 623 PPPP PPP G PPP + GG PPP Sbjct: 55 PPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPP 97 Score = 31.1 bits (67), Expect = 0.86 Identities = 16/46 (34%), Positives = 16/46 (34%) Frame = +1 Query: 484 GGPGXKXXPPXLXGXXFXSPPPXGGGWXXPXXPPPXKXGGGGGXPP 621 GG PP G PPP GGG PPP PP Sbjct: 76 GGSSYYYPPPSQSGGGSKYPPPYGGGGQGYYYPPPYSGNYPTPPPP 121 Score = 27.9 bits (59), Expect = 8.0 Identities = 19/64 (29%), Positives = 21/64 (32%), Gaps = 6/64 (9%) Frame = +2 Query: 509 PPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGG--XXXPPXN----XXXXPPPXXGXXGG 670 P P PPP PP P GGG PP + PPP G G Sbjct: 45 PVQSSPPPPSPPPPSTPTTACPPPPSPPSSGGGSSYYYPPPSQSGGGSKYPPPYGGGGQG 104 Query: 671 GFVP 682 + P Sbjct: 105 YYYP 108 >At4g13340.1 68417.m02084 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 760 Score = 36.3 bits (80), Expect = 0.023 Identities = 21/80 (26%), Positives = 24/80 (30%) Frame = +3 Query: 408 PPRGXLKXKXPXGFPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPP 587 PP + P P P + PPPP PPP + PPP Sbjct: 443 PPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPP 502 Query: 588 PKXXGGGXXPPPKTXXXXPP 647 P PPP PP Sbjct: 503 PPPPPPVYSPPPPPVYSSPP 522 Score = 35.5 bits (78), Expect = 0.040 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP V PPPP PP PPP Sbjct: 440 PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPPVYSPPPPSPPPPPP 492 Score = 35.1 bits (77), Expect = 0.053 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP V PPPP PP PPP Sbjct: 471 PPPPPPPPVYSPPPPSPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPP 523 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 431 PPPPVYSPPPPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPPP 478 Score = 31.9 bits (69), Expect = 0.49 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP V PPPP PP PPP Sbjct: 427 PPPSPPPPVYSPP--PPPPPPPPVYSPPPPPPPPPPPPVYSPPPPPPPPPPPP 477 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/53 (32%), Positives = 18/53 (33%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP + PPPP PP PPP Sbjct: 605 PVYSPPPPP---PCIEPPPPPPCIEYSPPPPPPVVHYSSPPPPPVYYSSPPPP 654 Score = 30.7 bits (66), Expect = 1.1 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP + PPPP PPP PP Sbjct: 618 PPPPPPCIEYSPPPPPP--VVHYSSPPPPPVYYSSPPPPPVYYSSPPP 663 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP + PPPP PPP PP Sbjct: 629 PPPPPPVVHYSSPPPPP--VYYSSPPPPPVYYSSPPPPPPVHYSSPPP 674 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP+ PP Sbjct: 641 PPPPPVYYSSPPPPPVYYS-----SPPPPPPVHYSSPPPPEVHYHSPP 683 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/49 (32%), Positives = 17/49 (34%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P PP P + PPP PPPP PP PPP Sbjct: 426 PPPPSPPPPVYSPPPPPPPPPPVYSPPPPPPP---PPPPPVYSPPPPPP 471 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/39 (33%), Positives = 13/39 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPP 620 PPPP PPP PPPP PP Sbjct: 487 PPPPPPPVYSPPPPPPPPPPPPVYSPPPPPVYSSPPPPP 525 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/49 (30%), Positives = 16/49 (32%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P PP P + PPP PP P PP PPP Sbjct: 500 PPPPPPPPPVYSPPPPPV-YSSPPPPPSPAPTPVYCTRPPPPPPHSPPP 547 >At3g06750.1 68416.m00800 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 147 Score = 35.5 bits (78), Expect = 0.040 Identities = 22/57 (38%), Positives = 23/57 (40%), Gaps = 2/57 (3%) Frame = -3 Query: 606 PPPXFXGGGG-XXXPPTPXXXGGGXKXGPPQXGGXGFXPGXPXXXXKKXGV-XPENP 442 PPP GGGG P P GG K PP GG G+ P G P NP Sbjct: 54 PPPSSSGGGGSYYYSPPPPSSSGGVKY-PPPYGGDGYGGYYPPPYYGNYGTPPPPNP 109 Score = 33.5 bits (73), Expect = 0.16 Identities = 20/61 (32%), Positives = 21/61 (34%) Frame = -3 Query: 675 NPPPXXPXXGGGXXXXFXGGXXXPPPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFX 496 +PPP P GG G PP GG PP G G PP G G Sbjct: 50 SPPPPPPSSSGGG-----GSYYYSPPPPSSSGGVKYPPPYGGDGYGGYYPPPYYGNYGTP 104 Query: 495 P 493 P Sbjct: 105 P 105 Score = 33.5 bits (73), Expect = 0.16 Identities = 19/58 (32%), Positives = 20/58 (34%) Frame = +3 Query: 450 PGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 P P GG PPPP + PPP G PPP G PPP Sbjct: 51 PPPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGYGGYYPPP--YYGNYGTPPP 106 Score = 33.5 bits (73), Expect = 0.16 Identities = 14/38 (36%), Positives = 15/38 (39%) Frame = -1 Query: 611 PPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXF 498 PPPPP GGG PPP P GG + Sbjct: 52 PPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGY 89 Score = 32.7 bits (71), Expect = 0.28 Identities = 16/43 (37%), Positives = 16/43 (37%) Frame = -1 Query: 611 PPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXPGPP 483 PPPP GGG PPP G K P G PP Sbjct: 53 PPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGYGGYYPP 95 Score = 31.1 bits (67), Expect = 0.86 Identities = 22/62 (35%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXX--PPPPXKXGGGXXXPPXNXXXXPPPXXGXXGGGF 676 P P P PPP G GG PPPP GG PPP G GG+ Sbjct: 44 PVPSSYSPPP--PPPSSSGGGGSYYYSPPPPSSSGG---------VKYPPPYGGDGYGGY 92 Query: 677 VP 682 P Sbjct: 93 YP 94 Score = 29.5 bits (63), Expect = 2.6 Identities = 18/58 (31%), Positives = 18/58 (31%) Frame = +3 Query: 450 PGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 P P G PPP G PP G G PPP G PPP Sbjct: 52 PPPPPSSSGGGGSYYYSPPPPSSSGGVKYPPPYGGDGYGGYY--PPPYYGNYGTPPPP 107 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/55 (36%), Positives = 21/55 (38%), Gaps = 6/55 (10%) Frame = +2 Query: 503 PXPPXXGGPX---FXPPPXXXGVGGXXXPPPPXKXGGGXXXPP---XNXXXXPPP 649 P P GG + PPP GG PPP G G PP N PPP Sbjct: 54 PPPSSSGGGGSYYYSPPPPSSS-GGVKYPPPYGGDGYGGYYPPPYYGNYGTPPPP 107 >At4g20440.2 68417.m02983 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.1 bits (77), Expect = 0.053 Identities = 22/80 (27%), Positives = 27/80 (33%) Frame = +3 Query: 387 PXWGXVFPPRGXLKXKXPXGFPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLX 566 P +G PP G P G P F + P P G + PPP G+ Sbjct: 169 PPFGGQGPPMGR-GPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQ 227 Query: 567 GXXXPPPPKXXGGGXXPPPK 626 G P P G PP+ Sbjct: 228 GPPPPRPGMPPAPGGFAPPR 247 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 532 FXSPPPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPPXXGV 660 F PPP G P PPP G PP PPP G+ Sbjct: 195 FSGPPPPQYG-QRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGM 236 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXG--XXGGGF 676 P PP G PPP GG PPP PP PPP G GGF Sbjct: 198 PPPPQYGQRPMIPPP-----GGMMRGPPP---------PPHGMQGPPPPRPGMPPAPGGF 243 Query: 677 VPXK 688 P + Sbjct: 244 APPR 247 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 508 PPXLXGXXFXSPPPXGGGWXXP--XXPPPXKXGGGGGXPPXKXXXXPPPXXG 657 PP + PPP GG P PPP G PP + PPP G Sbjct: 156 PPIIRPPGQMLPPPPFGGQGPPMGRGPPPPY---GMRPPPQQFSGPPPPQYG 204 >At4g20440.1 68417.m02982 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|Q05856 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Drosophila melanogaster} Length = 257 Score = 35.1 bits (77), Expect = 0.053 Identities = 22/80 (27%), Positives = 27/80 (33%) Frame = +3 Query: 387 PXWGXVFPPRGXLKXKXPXGFPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLX 566 P +G PP G P G P F + P P G + PPP G+ Sbjct: 169 PPFGGQGPPMGR-GPPPPYGMRPPPQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHGMQ 227 Query: 567 GXXXPPPPKXXGGGXXPPPK 626 G P P G PP+ Sbjct: 228 GPPPPRPGMPPAPGGFAPPR 247 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/43 (37%), Positives = 17/43 (39%) Frame = +1 Query: 532 FXSPPPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPPXXGV 660 F PPP G P PPP G PP PPP G+ Sbjct: 195 FSGPPPPQYG-QRPMIPPPGGMMRGPPPPPHGMQGPPPPRPGM 236 Score = 29.9 bits (64), Expect = 2.0 Identities = 22/64 (34%), Positives = 23/64 (35%), Gaps = 2/64 (3%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXG--XXGGGF 676 P PP G PPP GG PPP PP PPP G GGF Sbjct: 198 PPPPQYGQRPMIPPP-----GGMMRGPPP---------PPHGMQGPPPPRPGMPPAPGGF 243 Query: 677 VPXK 688 P + Sbjct: 244 APPR 247 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/52 (34%), Positives = 20/52 (38%), Gaps = 2/52 (3%) Frame = +1 Query: 508 PPXLXGXXFXSPPPXGGGWXXP--XXPPPXKXGGGGGXPPXKXXXXPPPXXG 657 PP + PPP GG P PPP G PP + PPP G Sbjct: 156 PPIIRPPGQMLPPPPFGGQGPPMGRGPPPPY---GMRPPPQQFSGPPPPQYG 204 >At5g54650.2 68418.m06805 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.7 bits (76), Expect = 0.070 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXX-GVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXG 658 P P P GP PPP G GG PPPP G P P P G Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Score = 32.3 bits (70), Expect = 0.37 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 485 GXPGXXP--XPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPP 622 G P P PP GGP PPP G PPPP G PP Sbjct: 384 GPPRPPPPAPPPGSGGPKPPPPPGPKG----PRPPPPMSLGPKAPRPP 427 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXP 492 PPP P G P PPP G G PPP G + P G P Sbjct: 370 PPPPVP----APQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPK-AP 424 Query: 491 GPP 483 PP Sbjct: 425 RPP 427 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = -3 Query: 606 PPPXFXGGGGXXXPPTPXXX-GGGXKXGPPQXGGXGFXPGXPXXXXKKXGVXPENP 442 P P G PP P G G PP G G P P K P P Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At5g54650.1 68418.m06804 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 900 Score = 34.7 bits (76), Expect = 0.070 Identities = 20/57 (35%), Positives = 20/57 (35%), Gaps = 1/57 (1%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXX-GVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXG 658 P P P GP PPP G GG PPPP G P P P G Sbjct: 373 PVPAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSG 429 Score = 32.3 bits (70), Expect = 0.37 Identities = 19/48 (39%), Positives = 19/48 (39%), Gaps = 2/48 (4%) Frame = +2 Query: 485 GXPGXXP--XPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPP 622 G P P PP GGP PPP G PPPP G PP Sbjct: 384 GPPRPPPPAPPPGSGGPKPPPPPGPKG----PRPPPPMSLGPKAPRPP 427 Score = 29.9 bits (64), Expect = 2.0 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXP 492 PPP P G P PPP G G PPP G + P G P Sbjct: 370 PPPPVP----APQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPK-AP 424 Query: 491 GPP 483 PP Sbjct: 425 RPP 427 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/56 (30%), Positives = 17/56 (30%), Gaps = 1/56 (1%) Frame = -3 Query: 606 PPPXFXGGGGXXXPPTPXXX-GGGXKXGPPQXGGXGFXPGXPXXXXKKXGVXPENP 442 P P G PP P G G PP G G P P K P P Sbjct: 375 PAPQMPSSAGPPRPPPPAPPPGSGGPKPPPPPGPKGPRPPPPMSLGPKAPRPPSGP 430 >At2g04170.1 68415.m00402 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to NtN2 [Medicago truncatula] GI:3776084; contains Pfam profile PF00917: MATH domain Length = 420 Score = 34.7 bits (76), Expect = 0.070 Identities = 23/68 (33%), Positives = 23/68 (33%), Gaps = 3/68 (4%) Frame = +1 Query: 484 GGPGXKXXPPXLXGXXFXSP---PPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPPXX 654 GGPG P G P P G W P P P GGG G P P P Sbjct: 43 GGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPRGPRPG-GGGGPGPGPWSGPRGPRPGG 101 Query: 655 GVXGGGVC 678 G G C Sbjct: 102 GGGPGSGC 109 Score = 32.7 bits (71), Expect = 0.28 Identities = 24/76 (31%), Positives = 24/76 (31%), Gaps = 2/76 (2%) Frame = -3 Query: 657 PXXGGGXXXXFXGGXXXPP--PXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPGXP 484 P GG GG P P F GG P P GG G G GF P P Sbjct: 10 PGRGGRGFGGRGGGPGFGPGGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGP 69 Query: 483 XXXXKKXGVXPENPGG 436 G P GG Sbjct: 70 GPWSGPRGPRPGGGGG 85 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/61 (32%), Positives = 20/61 (32%) Frame = +2 Query: 485 GXPGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXGXX 664 G PG P GGP F P G GG P GG P P P G Sbjct: 22 GGPGFGP-----GGPGFGPGGPGFGPGGPGFGPGGPGFGGRGPRGPGFGPRGPGPWSGPR 76 Query: 665 G 667 G Sbjct: 77 G 77 Score = 28.3 bits (60), Expect = 6.1 Identities = 22/65 (33%), Positives = 22/65 (33%) Frame = -3 Query: 621 GGXXXPPPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPGXPXXXXKKXGVXPENP 442 GG F G GG P GG GP GG GF PG P G P Sbjct: 8 GGPGRGGRGFGGRGGG-----PGFGPGGPGFGP---GGPGFGPGGPGFGPGGPGFGGRGP 59 Query: 441 GGXXF 427 G F Sbjct: 60 RGPGF 64 >At3g44340.1 68416.m04764 sec23/sec24 transport family protein contains Pfam domains PF04811: Sec23/Sec24 trunk domain, PF04815: Sec23/Sec24 helical domain and PF04810: Sec23/Sec24 zinc finger Length = 1096 Score = 34.3 bits (75), Expect = 0.092 Identities = 31/108 (28%), Positives = 32/108 (29%) Frame = -1 Query: 656 PXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXPGPPXX 477 P GG GG P PP G G PPP G G P G GPP Sbjct: 142 PQPGGFPASGPPGGVPSGPPS--GARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPPS 199 Query: 476 XKKXXGFXRKTXGXFXF*XTPGGENXPPXGXXPGXXAKXXXNXFTXGP 333 G P PP PG A + FT GP Sbjct: 200 G-MHGGHLSNGPPPSGMPGGPLSNGPPPPMMGPG--AFPRGSQFTSGP 244 Score = 31.1 bits (67), Expect = 0.86 Identities = 19/60 (31%), Positives = 20/60 (33%), Gaps = 1/60 (1%) Frame = -3 Query: 678 TNPPPXXPXXGGGXXXXFXGGXXXPPPX-FXGGGGXXXPPTPXXXGGGXKXGPPQXGGXG 502 + PP G G G PPP GG PP GG GPP G G Sbjct: 158 SGPPSGARPIGFGSPPPMGPGMSMPPPSGMPGGPLSNGPPPSGMHGGHLSNGPPPSGMPG 217 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/64 (28%), Positives = 18/64 (28%), Gaps = 3/64 (4%) Frame = -1 Query: 665 PXTPXXGGGXXXXFXGGX---PPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFX 495 P P G GG PPP GG PP G G G Sbjct: 188 PGGPLSNGPPPSGMHGGHLSNGPPPSGMPGGPLSNGPPPPMMGPGAFPRGSQFTSGPMMA 247 Query: 494 PGPP 483 P PP Sbjct: 248 PPPP 251 >At2g04190.1 68415.m00404 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 411 Score = 34.3 bits (75), Expect = 0.092 Identities = 20/59 (33%), Positives = 22/59 (37%) Frame = -3 Query: 666 PXXPXXGGGXXXXFXGGXXXPPPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPG 490 P GGG + GG P + G G P P GG GP GG G PG Sbjct: 30 PAFGGRGGGPGRGYGGGPRVHGPGY-GIGSRGPDPGPGFFFGGAGPGPGYGGGGGHGPG 87 >At5g44500.1 68418.m05452 small nuclear ribonucleoprotein associated protein B, putative / snRNP-B, putative / Sm protein B, putative similar to SP|P27048 Small nuclear ribonucleoprotein associated protein B (snRNP-B) (Sm protein B) (Sm-B) (SmB) {Mus musculus} Length = 254 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/63 (33%), Positives = 23/63 (36%), Gaps = 4/63 (6%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGG----XXXPPXNXXXXPPPXXG 658 PG P P G PPP G+ PPP + GG PP PPP G Sbjct: 158 PGQMPPQPPFAGQGGPPPP--YGMRPPYPGPPPPQYGGQQRPMMIPPPGGMMRGPPPPHG 215 Query: 659 XXG 667 G Sbjct: 216 MQG 218 Score = 28.7 bits (61), Expect = 4.6 Identities = 18/54 (33%), Positives = 19/54 (35%) Frame = +1 Query: 487 GPGXKXXPPXLXGXXFXSPPPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPP 648 G G P + PPP GG P PP G G PP PPP Sbjct: 169 GQGGPPPPYGMRPPYPGPPPPQYGGQQRPMMIPP-PGGMMRGPPPPHGMQGPPP 221 Score = 28.3 bits (60), Expect = 6.1 Identities = 22/70 (31%), Positives = 27/70 (38%) Frame = +3 Query: 447 FPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPK 626 +PG P + GG + PP G PPP G+ G PPP + G PP Sbjct: 183 YPGPPPPQY---GGQQRPMMIPPPGGMMRGPPPP--HGMQG---PPPSRP---GMPPPGG 231 Query: 627 TXXXXPPXXG 656 PP G Sbjct: 232 APMFAPPHPG 241 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 33.9 bits (74), Expect = 0.12 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PPPP PPP G PPP G PPP Sbjct: 728 PPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPP 767 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/57 (29%), Positives = 17/57 (29%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGGG 674 PPPP PPP PPPP P P PP G G Sbjct: 576 PPPPPPLPSRSIPPPLAQPPPPRPPPPPPPPPSSRSIPSPSAPPPPPPPPPSFGSTG 632 Score = 31.9 bits (69), Expect = 0.49 Identities = 15/40 (37%), Positives = 15/40 (37%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPP 552 PPP P PPPPP F G QPPP Sbjct: 602 PPPPPPSSRSIPSPSAPPPPPPPPPSFGSTGNKRQAQPPP 641 Score = 31.9 bits (69), Expect = 0.49 Identities = 22/68 (32%), Positives = 23/68 (33%), Gaps = 6/68 (8%) Frame = +3 Query: 492 RXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGG--XXPPP----KTXXXXPPXX 653 R PPPP P P L PPPP G G PPP + PP Sbjct: 710 RLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPPP 769 Query: 654 GGXGGGGL 677 G G L Sbjct: 770 AGRGRASL 777 Score = 31.5 bits (68), Expect = 0.65 Identities = 22/70 (31%), Positives = 22/70 (31%), Gaps = 4/70 (5%) Frame = +3 Query: 450 PGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPP----KXXGGGXXP 617 P P F G R PPPP PPP PPPP G Sbjct: 621 PPPPPPSFGSTGNKRQAQPPPPP-----PPPPPTRIPAAKCAPPPPPPPPTSHSGSIRVG 675 Query: 618 PPKTXXXXPP 647 PP T PP Sbjct: 676 PPSTPPPPPP 685 Score = 31.5 bits (68), Expect = 0.65 Identities = 19/56 (33%), Positives = 20/56 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGG 671 PP P L PPP PPPP PPP + PP G G G Sbjct: 702 PPLPPSSTRLGAPPP---------PPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRG 748 Score = 31.1 bits (67), Expect = 0.86 Identities = 20/58 (34%), Positives = 21/58 (36%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGGGL 677 PPPP + PPP G PPP G PPP PP G GL Sbjct: 729 PPPPLSKTPVPPPPPGLG--RGTSSGPPPLGAKGSNAPPP-----PPPAGRGRASLGL 779 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/58 (31%), Positives = 19/58 (32%), Gaps = 4/58 (6%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP----KTXXXXPPXXGGXG 665 P PP PPP L PPPP PPP + PP G G Sbjct: 703 PLPPSSTRLGAPPPPPPPPLSKTPAPPPPPLSKTPVPPPPPGLGRGTSSGPPPLGAKG 760 Score = 28.3 bits (60), Expect = 6.1 Identities = 20/63 (31%), Positives = 21/63 (33%), Gaps = 5/63 (7%) Frame = +2 Query: 485 GXPGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPP-----XNXXXXPPP 649 G P P PP P PPP PPPP G PP + PPP Sbjct: 712 GAPPPPPPPPLSKTPAPPPPPLSK---TPVPPPPPGLGRGTSSGPPPLGAKGSNAPPPPP 768 Query: 650 XXG 658 G Sbjct: 769 PAG 771 >At1g15830.1 68414.m01900 expressed protein Length = 483 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 538 SPPPXGGGWXXPXXP--PPXKXGGGGGXPPXKXXXXPPPXXGVXGGG 672 +PPP GG P P PP K GGGG PPP G GGG Sbjct: 122 APPPIRGGGGEPAIPGAPPPKRGGGG---EPVIPGAPPPKRG--GGG 163 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 538 SPPPXGGGWXXPXXP--PPXKXGGGGGXPPXKXXXXPPPXXGVXGGG 672 +PPP GG P P PP K GGGG PPP G GGG Sbjct: 138 APPPKRGGGGEPVIPGAPPPKRGGGG---EPVIPGAPPPKRG--GGG 179 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 538 SPPPXGGGWXXPXXP--PPXKXGGGGGXPPXKXXXXPPPXXGVXGGG 672 +PPP GG P P PP K GGGG PPP G GGG Sbjct: 154 APPPKRGGGGEPVIPGAPPPKRGGGG---EPVIPGAPPPKRG--GGG 195 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 538 SPPPXGGGWXXPXXP--PPXKXGGGGGXPPXKXXXXPPPXXGVXGGG 672 +PPP GG P P PP K GGGG PPP G GGG Sbjct: 170 APPPKRGGGGEPVIPGAPPPKRGGGG---EPVIPGAPPPKRG--GGG 211 Score = 33.9 bits (74), Expect = 0.12 Identities = 21/47 (44%), Positives = 22/47 (46%), Gaps = 2/47 (4%) Frame = +1 Query: 538 SPPPXGGGWXXPXXP--PPXKXGGGGGXPPXKXXXXPPPXXGVXGGG 672 +PPP GG P P PP K GGGG PPP G GGG Sbjct: 186 APPPKRGGGGEPVIPGAPPPKRGGGG---EPVIPGAPPPKRG--GGG 227 Score = 33.5 bits (73), Expect = 0.16 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 4/68 (5%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXP--PPXXXGVGGXXXPP--PPXKXGGGXXXPPXNXXXXPPPXXG 658 PG P GG P PP G GG P PP K GGG PPP G Sbjct: 152 PGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPV---IPGAPPPKRG 208 Query: 659 XXGGGFVP 682 G +P Sbjct: 209 GGGEPVIP 216 Score = 32.3 bits (70), Expect = 0.37 Identities = 21/45 (46%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +1 Query: 541 PPPXGGG-WXXPXXPPPXKXGGGGGXPPXKXXXXPPPXXGVXGGG 672 PP GGG P PPP + GGGG P PPP G GGG Sbjct: 109 PPNRGGGETVIPGAPPPIR--GGGGEP--AIPGAPPPKRG--GGG 147 Score = 32.3 bits (70), Expect = 0.37 Identities = 24/68 (35%), Positives = 25/68 (36%), Gaps = 4/68 (5%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXP--PPXXXGVGGXXXPP--PPXKXGGGXXXPPXNXXXXPPPXXG 658 PG P GG P PP G GG P PP K GGG PPP G Sbjct: 120 PGAPPPIRGGGGEPAIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPV---IPGAPPPKRG 176 Query: 659 XXGGGFVP 682 G +P Sbjct: 177 GGGEPVIP 184 Score = 30.7 bits (66), Expect = 1.1 Identities = 21/58 (36%), Positives = 23/58 (39%), Gaps = 4/58 (6%) Frame = +2 Query: 521 GGPXFXP--PPXXXGVGGXXXP--PPPXKXGGGXXXPPXNXXXXPPPXXGXXGGGFVP 682 GG P PP G G P PPP + GGG P PPP G G +P Sbjct: 99 GGEPVIPGAPPPNRGGGETVIPGAPPPIRGGGGEPAIP----GAPPPKRGGGGEPVIP 152 Score = 30.7 bits (66), Expect = 1.1 Identities = 24/68 (35%), Positives = 24/68 (35%), Gaps = 4/68 (5%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXP--PPXXXGVGGXXXPP--PPXKXGGGXXXPPXNXXXXPPPXXG 658 PG P GG P PP G GG P PP K GGG P P G Sbjct: 184 PGAPPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGGGGEPV---IPGAPLPKRG 240 Query: 659 XXGGGFVP 682 G VP Sbjct: 241 GGGESVVP 248 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/48 (35%), Positives = 18/48 (37%), Gaps = 1/48 (2%) Frame = +1 Query: 538 SPPPXGGGWXXPXXP-PPXKXGGGGGXPPXKXXXXPPPXXGVXGGGVC 678 +PPP GG P P P GGGG P GV G C Sbjct: 218 APPPKRGGGGEPVIPGAPLPKRGGGGESVVPGAPPPKRGGGVIVNGGC 265 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 7/78 (8%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPP-XGGGXXKXXP------XXX 513 P P GGG G PPP GG PPP GGG P Sbjct: 120 PGAPPPIRGGGGEPAIPGA--PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG 177 Query: 512 GGXXFXPGPPXXXKKXXG 459 GG PG P + G Sbjct: 178 GGEPVIPGAPPPKRGGGG 195 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 7/78 (8%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPP-XGGGXXKXXP------XXX 513 P P GGG G PPP GG PPP GGG P Sbjct: 136 PGAPPPKRGGGGEPVIPGA--PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG 193 Query: 512 GGXXFXPGPPXXXKKXXG 459 GG PG P + G Sbjct: 194 GGEPVIPGAPPPKRGGGG 211 Score = 29.1 bits (62), Expect = 3.5 Identities = 24/78 (30%), Positives = 25/78 (32%), Gaps = 7/78 (8%) Frame = -1 Query: 671 PPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPP-XGGGXXKXXP------XXX 513 P P GGG G PPP GG PPP GGG P Sbjct: 168 PGAPPPKRGGGGEPVIPGA--PPPKRGGGGEPVIPGAPPPKRGGGGEPVIPGAPPPKRGG 225 Query: 512 GGXXFXPGPPXXXKKXXG 459 GG PG P + G Sbjct: 226 GGEPVIPGAPLPKRGGGG 243 >At3g22800.1 68416.m02874 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycsimilar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 470 Score = 33.1 bits (72), Expect = 0.21 Identities = 16/48 (33%), Positives = 17/48 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP + PPPP PPP PP Sbjct: 390 PPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 32.7 bits (71), Expect = 0.28 Identities = 18/53 (33%), Positives = 18/53 (33%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP V PPPP PP PPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPPP 438 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/53 (32%), Positives = 17/53 (32%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP PPPP PP PPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPYVYPPP 437 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 401 PPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY--VYPPPPSPPYVYPP 446 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/46 (32%), Positives = 15/46 (32%) Frame = +3 Query: 486 GXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 G PPPP PPP PPPP PPP Sbjct: 373 GCSPPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPPPP 418 >At2g32600.1 68415.m03980 hydroxyproline-rich glycoprotein family protein similar to SWISS-PROT:Q15428 Length = 277 Score = 33.1 bits (72), Expect = 0.21 Identities = 17/46 (36%), Positives = 17/46 (36%) Frame = +3 Query: 486 GXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 G PPPP PPP GL PPPP G P P Sbjct: 225 GANGLPPPPPPPPHQAQPPPPPPSGL---FPPPPPPMANNGFRPMP 267 Score = 30.7 bits (66), Expect = 1.1 Identities = 18/53 (33%), Positives = 19/53 (35%) Frame = +2 Query: 485 GXPGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXP 643 G P P PP P PPP G+ PPPP G PP P Sbjct: 228 GLPPPPPPPPHQAQP---PPPPPSGL--FPPPPPPMANNGFRPMPPAGGFGHP 275 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +2 Query: 542 PPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXGXXGGGFVP 682 P G G PPPP PP + PPP GF P Sbjct: 220 PQSAVGANGLPPPPPPPPHQAQPPPPPPSGLFPPPPPP-MANNGFRP 265 >At5g58470.2 68418.m07323 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 540 PPPXXX--GLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGG 671 PPP G PPP G PPP + PP GG GG Sbjct: 182 PPPAAAIPSYDGSGSYPPPTGYGMEAVPPPTSYSGGPPSYGGPRGG 227 >At5g58470.1 68418.m07322 zinc finger (Ran-binding) family protein weak similarity to SP|Q01844 RNA-binding protein EWS (EWS oncogene) (Ewing sarcoma breakpoint region 1 protein) {Homo sapiens}; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF00641: Zn-finger in Ran binding protein and others Length = 422 Score = 32.3 bits (70), Expect = 0.37 Identities = 17/46 (36%), Positives = 18/46 (39%), Gaps = 2/46 (4%) Frame = +3 Query: 540 PPPXXX--GLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGGXGGG 671 PPP G PPP G PPP + PP GG GG Sbjct: 182 PPPAAAIPSYDGSGSYPPPTGYGMEAVPPPTSYSGGPPSYGGPRGG 227 >At4g16140.1 68417.m02445 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 164 Score = 31.5 bits (68), Expect = 0.65 Identities = 19/56 (33%), Positives = 20/56 (35%), Gaps = 4/56 (7%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKT----XXXXPPXXGG 659 PPPP PPP G G PP G PPP + PP GG Sbjct: 56 PPPPSPTTTACPPPPSSSG-GGPYYYYPPASQSGSYRPPPSSSSGGYYYPPPKSGG 110 Score = 31.1 bits (67), Expect = 0.86 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Frame = +3 Query: 504 PPPPXX--GXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXP 644 PPPP G PP G PPP GG PPPK+ P Sbjct: 67 PPPPSSSGGGPYYYYPPASQS--GSYRPPPSSSSGGYYYPPPKSGGNYP 113 Score = 30.7 bits (66), Expect = 1.1 Identities = 20/66 (30%), Positives = 21/66 (31%), Gaps = 3/66 (4%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGG---XXXPPXNXXXXPPPXXGXXGGG 673 P PP PPP PPPP GGG P PP GG Sbjct: 45 PSPPPPPSNPSPPPPSPTTTA---CPPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGY 101 Query: 674 FVPXKK 691 + P K Sbjct: 102 YYPPPK 107 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/41 (34%), Positives = 16/41 (39%) Frame = -1 Query: 608 PPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGGXXFXPGP 486 PPPP GGG PP G + P G + P P Sbjct: 67 PPPPSSSGGGPY-YYYPPASQSGSYRPPPSSSSGGYYYPPP 106 Score = 28.3 bits (60), Expect = 6.1 Identities = 18/59 (30%), Positives = 20/59 (33%), Gaps = 4/59 (6%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGG----XXPPPKTXXXXPPXXGGXGG 668 PPPP P P PPPP GGG P ++ PP GG Sbjct: 47 PPPPPSNPSPPPPSPTTTAC-----PPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGG 100 Score = 27.9 bits (59), Expect = 8.0 Identities = 17/59 (28%), Positives = 18/59 (30%), Gaps = 3/59 (5%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXN---XXXXPPPXXG 658 P PP PPP GG PP G PP + PPP G Sbjct: 51 PSNPSPPPPSPTTTACPPPPSSSGGGPYYYYPPASQSGSYRPPPSSSSGGYYYPPPKSG 109 >At3g22070.1 68416.m02785 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 178 Score = 31.5 bits (68), Expect = 0.65 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 P PP PPP PPPP PPP T PP Sbjct: 99 PNPPAPIVNPNPPPPSTPNPPPEFSPPPPDLDTTTAPPPPSTDIPIPP 146 >At1g26250.1 68414.m03202 proline-rich extensin, putative similar to extensin gi|1165322|gb|AAB53156; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 443 Score = 31.5 bits (68), Expect = 0.65 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 278 KSPPPPPYVYSSPPPPPYVYS-----SPPPPPYVYSSPPPPPYVYKSPPP 322 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 108 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYSSPPP 152 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 198 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 242 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 218 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 262 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 238 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 282 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 258 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYSSPPP 302 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 128 KSPPPPPYVYSSPPPPPYVYS-----SPPPPPYVYKSPPPPPYVYSPPPP 172 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 158 KSPPPPPYVYSPPPPPPYVY-----QSPPPPPYVYSSPPPPPYVYKSPPP 202 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 70 PPPPPYVYSSPPPPPYVYN-----SPPPPPYVYSSPPPPPYVYKSPPP 112 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 120 PPPPPYVYKSPPPPPYVYS-----SPPPPPYVYSSPPPPPYVYKSPPP 162 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 270 PPPPPYVYKSPPPPPYVYS-----SPPPPPYVYSSPPPPPYVYSSPPP 312 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 90 PPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 180 PPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 222 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 290 PPPPPYVYSSPPPPPYVYS-----SPPPPPYVYKSPPPPPYVYTSPPP 332 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 300 PPPPPYVYSSPPPPPYVY-----KSPPPPPYVYTSPPPPPYVYKSPPP 342 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 310 PPPPPYVYKSPPPPPYVY-----TSPPPPPYVYKSPPPPPYVDSYSPP 352 >At5g45350.1 68418.m05567 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 177 Score = 31.1 bits (67), Expect = 0.86 Identities = 22/76 (28%), Positives = 25/76 (32%) Frame = +3 Query: 438 PXGFPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXP 617 P G+P P + G + PPPP PP G P P G G P Sbjct: 18 PAGYP--PPGAYPPAGYPQQGYPPPPGAYPPAGYPPGAYPPAPGGYPPAP----GYGGYP 71 Query: 618 PPKTXXXXPPXXGGXG 665 P PP G G Sbjct: 72 PAPGYGGYPPAPGHGG 87 >At5g19810.1 68418.m02354 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 249 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/58 (29%), Positives = 18/58 (31%) Frame = +3 Query: 450 PGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 P P F + PPPP P P PPPP G PPP Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPPRPQAAAYYKKTPPPPPYKYGRVYPPPP 209 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/47 (36%), Positives = 17/47 (36%), Gaps = 5/47 (10%) Frame = +3 Query: 498 KXPPPPXX--GXXLXXPPPXXXGLXG---XXXPPPPKXXGGGXXPPP 623 K PPPP G PPP PPPP G PPP Sbjct: 192 KTPPPPPYKYGRVYPPPPPPPQAARSYKRSPPPPPPSKYGRVYSPPP 238 >At5g07780.1 68418.m00890 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 464 Score = 31.1 bits (67), Expect = 0.86 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPKT P Sbjct: 33 PPPPLMRRRAPPPPPPPLMRRRAPPPPPPPPLPRPCSRPPKTKCSLKP 80 Score = 29.9 bits (64), Expect = 2.0 Identities = 17/48 (35%), Positives = 17/48 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP L PPPP PPP PP Sbjct: 18 PPPPLMRRRAPLPPPPPPPLMRRRAPPPP--------PPPLMRRRAPP 57 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 31.1 bits (67), Expect = 0.86 Identities = 13/40 (32%), Positives = 14/40 (35%) Frame = +3 Query: 540 PPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGG 659 PPP PPPP G PP + PP G Sbjct: 30 PPPSDSSSPSPPAPPPPDDSSNGSPQPPSSDSQSPPSPQG 69 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 541 PPPXGGGWXXPXXPPPXKXGGG 606 PPP G W PPP GG Sbjct: 268 PPPPPGSWQPSPPPPPPPVSGG 289 >At1g26240.1 68414.m03201 proline-rich extensin-like family protein similar to hydroxyproline-rich glycoprotein precursor gi|727264|gb|AAA87902; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 478 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 88 KSPPPPPYVYSSPPPPPYIY-----KSPPPPPYVYSSPPPPPYVYKSPPP 132 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 108 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYNSPPPPPYVYKSPPP 152 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 128 KSPPPPPYVYNSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 172 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 148 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 192 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 168 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 212 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 188 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 232 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 208 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 252 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 228 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 272 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 248 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 292 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 268 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 312 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 288 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 332 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 308 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYNSPPPPPYVYKSPPP 352 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 368 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 412 Score = 31.1 bits (67), Expect = 0.86 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 388 KSPPPPPYVYSSPPPPPYVY-----KSPPPPPYVYSSPPPPPYVYKSPPP 432 Score = 30.7 bits (66), Expect = 1.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 68 KSPPPPPYVYSSPPPPPYI-----YKSPPPPPYVYSSPPPPPYIYKSPPP 112 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 50 PPPPPYVYSSPPPPPYIY-----KSPPPPPYVYSSPPPPPYIYKSPPP 92 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 320 PPPPPYVYKSPPPPPYVYN-----SPPPPPYVYKSPPPPPYVYSSPPP 362 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 400 PPPPPYVYKSPPPPPYVYS-----SPPPPPYVYKSPPPPPYVYSSPPP 442 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 420 PPPPPYVYKSPPPPPYVYS-----SPPPPPYVYKSPSPPPYVYKSPPP 462 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/48 (33%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 60 PPPPPYIYKSPPPPPYVYS-----SPPPPPYIYKSPPPPPYVYSSPPP 102 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/50 (34%), Positives = 17/50 (34%) Frame = +3 Query: 498 KXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 K PPPP PPP PPPP PPP PP Sbjct: 348 KSPPPPPY--VYSSPPPSPYVYKS---PPPPPYVYSSPPPPPYVYKSPPP 392 >At5g19090.1 68418.m02269 heavy-metal-associated domain-containing protein contains Pfam heavy-metal-associated domain PF00403; glycine-rich protein GRP22, rape, PIR:S31415; isoform contains a non-consensus TG-acceptor splice site at intron 3 Length = 587 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/72 (30%), Positives = 23/72 (31%) Frame = -2 Query: 622 GGGXXPPPXFXGGGGXXXPXNPXXXGGGXKXXXPXXGGGGXXXRXPPKXXKKXXGXPGKP 443 GGG P GGGG P GG GGGG P + G G Sbjct: 359 GGGGGGPNGNKGGGGVQMNGGPN--GGKKGGGGGGGGGGGPMSGGLPPGFRPMGGGGGGG 416 Query: 442 XGXXFFKXPRGG 407 G P GG Sbjct: 417 GGPQSMSMPMGG 428 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/75 (30%), Positives = 23/75 (30%), Gaps = 4/75 (5%) Frame = -3 Query: 648 GGGXXXXFXGGXXXPPPXFXGGGGXXXPPTPXXXG----GGXKXGPPQXGGXGFXPGXPX 481 GGG GG P GGGG G GG G GG G G P Sbjct: 339 GGGGKNGGKGGGGHPLDGKMGGGGGGPNGNKGGGGVQMNGGPNGGKKGGGGGGGGGGGPM 398 Query: 480 XXXKKXGVXPENPGG 436 G P GG Sbjct: 399 SGGLPPGFRPMGGGG 413 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +1 Query: 541 PPPXGGGWXXPXXPPPXKXGGGGGXPPXK 627 P P GG P P + GGGGG P K Sbjct: 294 PGPAGGKIEGKGMPFPVQMGGGGGGPGGK 322 Score = 28.3 bits (60), Expect = 6.1 Identities = 21/54 (38%), Positives = 22/54 (40%), Gaps = 7/54 (12%) Frame = -3 Query: 648 GGGXXXXFXGGXXXPP---PXFXGGGGXXXPPTPXXXGGGXKXGP----PQXGG 508 GGG GG PP P GGGG P + GG GP PQ GG Sbjct: 391 GGGGGGPMSGGL--PPGFRPMGGGGGGGGGPQSMSMPMGGAMGGPMGSLPQMGG 442 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/49 (36%), Positives = 19/49 (38%), Gaps = 4/49 (8%) Frame = +1 Query: 484 GGPGXKXXPPXLXGXXFXSPPPXGGGWXXPXX----PPPXKXGGGGGXP 618 GGPG K P G + GGG P K GGGGG P Sbjct: 317 GGPGGKKGGPGGGGGNMGNQNQGGGGKNGGKGGGGHPLDGKMGGGGGGP 365 >At5g23150.1 68418.m02707 PWWP domain-containing protein identical to cDNA putative transcription factor (HUA2) GI:4868119; contains Pfam profile PF00855: PWWP domain Length = 1392 Score = 30.3 bits (65), Expect = 1.5 Identities = 15/48 (31%), Positives = 16/48 (33%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPP PPP L PPP + PPP PP Sbjct: 1080 PPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/46 (32%), Positives = 16/46 (34%) Frame = +3 Query: 510 PPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PP PPP L PPPP PPP + PP Sbjct: 1069 PPPLPPLPPSPPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPP 1114 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/49 (30%), Positives = 17/49 (34%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P PP P PP PPPP + PP + PPP Sbjct: 1079 PPPPSPPLPPSSLPPPPPAALFPPLPPPPSQPPPPPLSPPPSPPPPPPP 1127 >At1g24150.1 68414.m03047 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 725 Score = 30.3 bits (65), Expect = 1.5 Identities = 16/40 (40%), Positives = 16/40 (40%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PPPP PPP PPPPK G PPP Sbjct: 247 PPPPIPVKQSATPPP----------PPPPKLKNNGPSPPP 276 >At1g23040.1 68414.m02878 hydroxyproline-rich glycoprotein family protein contains proline-rich domains, INTERPRO:IPR000694 Length = 144 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPP 589 P P PP P PPP V PPPP Sbjct: 65 PPPSPPPPACPPPPALPPPPPKKVSSYCPPPPP 97 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/44 (31%), Positives = 14/44 (31%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPP 622 P PP P PPP PPPP K PP Sbjct: 53 PSCIQNPPPPSPPPPSPPPPACPPPPALPPPPPKKVSSYCPPPP 96 >At5g07770.1 68418.m00889 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 722 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/47 (29%), Positives = 15/47 (31%) Frame = +1 Query: 508 PPXLXGXXFXSPPPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPP 648 P + G PP G P PPP PP PPP Sbjct: 3 PVEITGADAVVTPPMRGRVPLPPPPPPPMRRSAPSPPPMSGRVPPPP 49 Score = 28.3 bits (60), Expect = 6.1 Identities = 10/19 (52%), Positives = 10/19 (52%) Frame = +3 Query: 567 GXXXPPPPKXXGGGXXPPP 623 G PPPP GG PPP Sbjct: 636 GSPSPPPPSMSGGAPPPPP 654 Score = 26.6 bits (56), Expect(2) = 1.8 Identities = 11/29 (37%), Positives = 11/29 (37%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPP 590 PPPP PPP L PPP Sbjct: 640 PPPPSMSGGAPPPPPPPPMLVASRTAPPP 668 Score = 21.8 bits (44), Expect(2) = 1.8 Identities = 9/17 (52%), Positives = 9/17 (52%), Gaps = 2/17 (11%) Frame = +3 Query: 579 PPP--PKXXGGGXXPPP 623 PPP P GG PPP Sbjct: 698 PPPTLPSMSGGAPPPPP 714 >At3g08530.1 68416.m00990 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1703 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/40 (35%), Positives = 16/40 (40%) Frame = +2 Query: 527 PXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPP 646 P P P G+GG PP + GG PP PP Sbjct: 1660 PLALPAPPMPGMGGGGGYGPPPQMGGMPGMPPMPPYGMPP 1699 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/28 (46%), Positives = 13/28 (46%) Frame = -3 Query: 567 PPTPXXXGGGXKXGPPQXGGXGFXPGXP 484 PP P GGG PPQ GG P P Sbjct: 1666 PPMPGMGGGGGYGPPPQMGGMPGMPPMP 1693 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/42 (33%), Positives = 15/42 (35%) Frame = +3 Query: 531 LXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXG 656 L P P G+ G PP GG PP PP G Sbjct: 1661 LALPAPPMPGMGGGGGYGPPPQMGGMPGMPPMPPYGMPPMGG 1702 >At2g10940.2 68415.m01168 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGG 659 P PP G L PP G PP G PPP + PP GG Sbjct: 155 PIPPVVGPNLPLPPLPIVGPILPPGTTPPATGGKDCPPPPGS--VKPPSGGG 204 >At2g10940.1 68415.m01167 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 291 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/52 (34%), Positives = 19/52 (36%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPPXXGG 659 P PP G L PP G PP G PPP + PP GG Sbjct: 155 PIPPVVGPNLPLPPLPIVGPILPPGTTPPATGGKDCPPPPGS--VKPPSGGG 204 >At1g49750.1 68414.m05579 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560 Length = 494 Score = 29.9 bits (64), Expect = 2.0 Identities = 15/47 (31%), Positives = 16/47 (34%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXP 644 PPPP PPP PPPP+ PPP P Sbjct: 64 PPPPPPCPPPPSPPPCPPPPSPPPSPPPPQLPPPPQLPPPAPPKPQP 110 >At5g26080.1 68418.m03103 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 141 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/50 (32%), Positives = 17/50 (34%), Gaps = 2/50 (4%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXP--PPKTXXXXPP 647 PPPP + PPP PPPP P PP PP Sbjct: 42 PPPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPP 91 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/50 (32%), Positives = 16/50 (32%), Gaps = 2/50 (4%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPP--KXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPP PPP PP Sbjct: 43 PPPPYRSPVTIPPPPPVYSRPVAFPPPPPIYSPPPPPIYPPPIYSPPPPP 92 >At4g18570.1 68417.m02749 proline-rich family protein common family members: At3g25690, At4g04980, At5g61090 [Arabidopsis thaliana] Length = 642 Score = 29.5 bits (63), Expect = 2.6 Identities = 16/42 (38%), Positives = 17/42 (40%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKT 629 PPPP L PPP PPPP PPPK+ Sbjct: 312 PPPPPPPPLLQQPPPPPSVSKAPPPPPPP--------PPPKS 345 >At1g79730.1 68414.m09300 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 589 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/52 (32%), Positives = 17/52 (32%), Gaps = 3/52 (5%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXG---GGXXXPPXNXXXXPPP 649 P PP P PPP PPPP G P N PPP Sbjct: 23 PPPPPSLPPPVPPPPPSHQPYSYPPPPPPPPHAYYQQGPHYPQFNQLQAPPP 74 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/45 (33%), Positives = 15/45 (33%), Gaps = 1/45 (2%) Frame = +3 Query: 492 RXKXPP-PPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 R PP P PPP L PPPP PPP Sbjct: 5 RPPYPPLPQPPSQNSLAPPPPPPSLPPPVPPPPPSHQPYSYPPPP 49 >At1g62440.1 68414.m07044 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 826 Score = 29.5 bits (63), Expect = 2.6 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXP 644 P PP PPP PPPP PPP P Sbjct: 596 PSPPYYQYTSSPPPPTYYATQSPPPPPPPTYYAVQSPPPPPPVYYPP 642 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PP PPPP PPP PP Sbjct: 503 PPPPPEYEPSPPPPSSEMSPSVRAYPPPPPLSPPPPSPPPPYIYSSPP 550 >At1g53260.1 68414.m06035 hypothetical protein low similarity to SP|Q38732 DAG protein, chloroplast precursor {Antirrhinum majus} Length = 358 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/42 (35%), Positives = 15/42 (35%), Gaps = 2/42 (4%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXG--LXGXXXPPPPKXXGGGXXPPP 623 PPPP PPP G G PPP PPP Sbjct: 280 PPPPNMNQSYQGPPPSNMGQNYRGPSLPPPNMSQNYEGPPPP 321 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PP P PPP G PPPP PPP Sbjct: 244 PPAPNMNQNYQGPPPSNMG-QNYQGPPPPNMNQSYQGPPP 282 Score = 29.1 bits (62), Expect = 3.5 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PPP G PPP PPPP PPP Sbjct: 256 PPPSNMGQNYQGPPPPNMN-QSYQGPPPPNMNQSYQGPPP 294 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/67 (29%), Positives = 22/67 (32%), Gaps = 6/67 (8%) Frame = +3 Query: 486 GXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXG----GGXXPPP--KTXXXXPP 647 G + PPPP PPP + PPP G G PPP PP Sbjct: 262 GQNYQGPPPPNMNQSYQGPPP--PNMNQSYQGPPPSNMGQNYRGPSLPPPNMSQNYEGPP 319 Query: 648 XXGGXGG 668 GG Sbjct: 320 PPNMNGG 326 >At1g31750.1 68414.m03895 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 176 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/59 (28%), Positives = 21/59 (35%), Gaps = 2/59 (3%) Frame = +3 Query: 438 PXGFPGKPXXFFXXXGGXRXKXPPPPXXG--XXLXXPPPXXXGLXGXXXPPPPKXXGGG 608 P +P P + GG + PPP G PPP G P P+ GG Sbjct: 26 PGAYPPPPQGAYPPPGGYPPQGYPPPPHGYPPAAYPPPPGAYPPAGYPGPSGPRPGFGG 84 >At1g21310.1 68414.m02662 proline-rich extensin-like family protein contains extensin-like region, Pfam:PF04554 Length = 431 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 57 PPPPKKHYEYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 107 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 85 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 135 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 113 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 163 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 141 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 191 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 169 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 219 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 197 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 247 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 225 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 275 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 253 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 303 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 281 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 331 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 309 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 359 Score = 29.5 bits (63), Expect = 2.6 Identities = 17/51 (33%), Positives = 17/51 (33%), Gaps = 3/51 (5%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXX---PPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPPPK PPP PP Sbjct: 337 PPPPKKHYVYKSPPPPVKHYSPPPVYHSPPPPKKHYVYKSPPPPVKHYSPP 387 >At5g11990.1 68418.m01402 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 181 Score = 29.1 bits (62), Expect = 3.5 Identities = 15/48 (31%), Positives = 17/48 (35%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPP + PP L PPPP PPP + PP Sbjct: 44 PPPSKPSPSMSPPPSPSLPLSSSPPPPPPHKHS----PPPLSQSLSPP 87 >At4g03120.1 68417.m00425 proline-rich family protein similar to U1 small nuclear ribonucleoprotein C; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 207 Score = 29.1 bits (62), Expect = 3.5 Identities = 20/56 (35%), Positives = 21/56 (37%), Gaps = 3/56 (5%) Frame = +1 Query: 490 PGXKXXPPXLXGXXFX---SPPPXGGGWXXPXXPPPXKXGGGGGXPPXKXXXXPPP 648 PG PP G +P P GG P P G GGG PP PPP Sbjct: 122 PGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIP---GQGGGPPPNYNGLPPPP 174 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP PP G PP G PP N PPP Sbjct: 121 PPGAPLPPPPQNGILRPPGMAPIPGQGGGPPGMAPIPGQGGGPPPNYNGLPPP 173 >At1g54215.1 68414.m06180 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 169 Score = 26.2 bits (55), Expect(2) = 3.5 Identities = 11/25 (44%), Positives = 11/25 (44%) Frame = -2 Query: 673 PPPPXPPXXGGXXXXVXGGGXXPPP 599 PPPP PP V G PPP Sbjct: 55 PPPPPPPPPPAVNMSVETGIPPPPP 79 Score = 21.4 bits (43), Expect(2) = 3.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -2 Query: 688 FXXXKPPPPXPP 653 F PPPP PP Sbjct: 38 FPQSPPPPPPPP 49 >At5g62640.1 68418.m07862 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 520 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/39 (35%), Positives = 15/39 (38%) Frame = +3 Query: 507 PPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PPP G PPP PPPP+ PPP Sbjct: 219 PPPPPG-----PPPKEQDFVRPPLPPPPQLPQSSQPPPP 252 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/53 (30%), Positives = 18/53 (33%), Gaps = 5/53 (9%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPP-----PKXXGGGXXPPPKTXXXXPP 647 PPPP P P G+ PP P+ PPP T PP Sbjct: 728 PPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPPPTAPPPPP 780 >At4g18670.1 68417.m02762 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 839 Score = 28.7 bits (61), Expect = 4.6 Identities = 15/47 (31%), Positives = 15/47 (31%) Frame = +2 Query: 509 PPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 PP P PP V PPPP PP PPP Sbjct: 768 PPPPPSPAHYSPPPSPPVYYYNSPPPPPAVHYSPPPPPVIHHSQPPP 814 >At3g20850.1 68416.m02636 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 134 Score = 28.7 bits (61), Expect = 4.6 Identities = 19/73 (26%), Positives = 23/73 (31%), Gaps = 1/73 (1%) Frame = +3 Query: 408 PPRGXLKXKXPXGFPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXX-GLXGXXXPP 584 PP + P P P ++ PP P + PPP PP Sbjct: 56 PPPTPVYSPPPADLPPPPTPYYSPPADL---PPPTPIYPPPVAFPPPQAYQAYYYRKSPP 112 Query: 585 PPKXXGGGXXPPP 623 PP G PPP Sbjct: 113 PPPSKYGKVYPPP 125 >At2g18470.1 68415.m02151 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 633 Score = 28.7 bits (61), Expect = 4.6 Identities = 20/63 (31%), Positives = 21/63 (33%) Frame = +2 Query: 485 GXPGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPPXXGXX 664 G G PP G P PP G G PP GG + PP G Sbjct: 87 GNNGGNDTPPSRGSPP-SPPSRSNGDNGGSRSSPPGDTGG-------SRSDNPPSSGGSS 138 Query: 665 GGG 673 GGG Sbjct: 139 GGG 141 Score = 28.7 bits (61), Expect = 4.6 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -3 Query: 648 GGGXXXXFXGGXXXPPPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGG 508 GG G PP G G P GG PP GG Sbjct: 90 GGNDTPPSRGSPPSPPSRSNGDNGGSRSSPPGDTGGSRSDNPPSSGG 136 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/47 (29%), Positives = 14/47 (29%) Frame = -1 Query: 647 GGGXXXXFXGGXPPPPPXFXGGGXXGXXQPPPXGGGXXKXXPXXXGG 507 GG G P PP G PP GG P GG Sbjct: 90 GGNDTPPSRGSPPSPPSRSNGDNGGSRSSPPGDTGGSRSDNPPSSGG 136 >At1g24490.1 68414.m03084 60 kDa inner membrane family protein similar to chloroplast membrane protein (ALBINO3) (GI:3927828) [Arabidopsis thaliana] Length = 1013 Score = 28.7 bits (61), Expect = 4.6 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = -2 Query: 655 PXXGGXXXXVXGGGXXPPPXFXGGGGXXXPXNPXXXGGGXK 533 P G GGG PP GGGG +P GGG K Sbjct: 408 PGGGSGSPPSTGGGSGSPPSTGGGGG-----SPSKGGGGGK 443 >At4g33970.1 68417.m04820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 699 Score = 28.3 bits (60), Expect = 6.1 Identities = 16/53 (30%), Positives = 16/53 (30%) Frame = +2 Query: 491 PGXXPXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXGGGXXXPPXNXXXXPPP 649 P P PP P PPP PPPP P PPP Sbjct: 546 PVHSPPPPPVYSPPPPPPPVHSPPPPVFSPPPPVYSPPPPVHSPPPPVHSPPP 598 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/48 (31%), Positives = 15/48 (31%) Frame = +3 Query: 504 PPPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPPKTXXXXPP 647 PPPP PPP PPP PPP PP Sbjct: 526 PPPPVYSPP--PPPPPVHSPPPPVHSPPPPPVYSPPPPPPPVHSPPPP 571 >At3g29060.1 68416.m03635 EXS family protein / ERD1/XPR1/SYG1 family protein similar to PHO1 protein [Arabidopsis thaliana] GI:20069032; contains Pfam profiles PF03105: SPX domain, PF03124: EXS family Length = 794 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 579 PPPPKXXGGGXXPPPKTXXXXPPXXGGXGGGGL 677 PPPP G P KT GG GG GL Sbjct: 44 PPPPPPPSTGDTVPLKTDGGEGGGGGGGGGPGL 76 >At3g10300.3 68416.m01236 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 335 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -3 Query: 603 PPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPGXP 484 PP G G PP P G PP G G P P Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPP 44 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 533 FXPPPXXXGVGGXXXPPPPXKXGGGXXXPP-XNXXXXPPPXXG 658 + P G GG PP P G PP + PPP G Sbjct: 4 YPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYG 46 >At3g10300.2 68416.m01235 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 324 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -3 Query: 603 PPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPGXP 484 PP G G PP P G PP G G P P Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPP 44 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 533 FXPPPXXXGVGGXXXPPPPXKXGGGXXXPP-XNXXXXPPPXXG 658 + P G GG PP P G PP + PPP G Sbjct: 4 YPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYG 46 >At3g10300.1 68416.m01234 calcium-binding EF hand family protein low similarity to SP|P12815 Programmed cell death protein 6 (Probable calcium-binding protein ALG-2) {Mus musculus}; contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 232 Score = 28.3 bits (60), Expect = 6.1 Identities = 14/40 (35%), Positives = 14/40 (35%) Frame = -3 Query: 603 PPXFXGGGGXXXPPTPXXXGGGXKXGPPQXGGXGFXPGXP 484 PP G G PP P G PP G G P P Sbjct: 5 PPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPP 44 Score = 27.9 bits (59), Expect = 8.0 Identities = 14/43 (32%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Frame = +2 Query: 533 FXPPPXXXGVGGXXXPPPPXKXGGGXXXPP-XNXXXXPPPXXG 658 + P G GG PP P G PP + PPP G Sbjct: 4 YPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYG 46 >At3g06130.1 68416.m00704 heavy-metal-associated domain-containing protein contains Pfam heavy metal associated domain PF00403 Length = 473 Score = 28.3 bits (60), Expect = 6.1 Identities = 24/78 (30%), Positives = 24/78 (30%), Gaps = 4/78 (5%) Frame = -2 Query: 658 PPXXGGXXXXVXGGGXXPPPXFXGGGGXXXPXNP----XXXGGGXKXXXPXXGGGGXXXR 491 P GG GGG GGG P N GGG GGGG Sbjct: 252 PAKNGGKGAPAAGGGGAGGGKGAGGGAKGGPGNQNQGGGKNGGGGHPQDGKNGGGGGG-- 309 Query: 490 XPPKXXKKXXGXPGKPXG 437 P KK G G G Sbjct: 310 --PNAGKKGNGGGGPMAG 325 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 28.3 bits (60), Expect = 6.1 Identities = 21/72 (29%), Positives = 22/72 (30%), Gaps = 3/72 (4%) Frame = -1 Query: 689 FLXXQTPPPXTPXXGGGXXXXFXGGXPPPPPXFXGGGXXGXXQP---PPXGGGXXKXXPX 519 F Q PP P F G PPPPP G G P GG + P Sbjct: 288 FRPPQGMPPPPPPQFLNHQQGFGGPRPPPPPQAMGMHQHGGWPPQHMQQQGGPPQQQQPP 347 Query: 518 XXGGXXFXPGPP 483 P PP Sbjct: 348 YQHHHMSMPPPP 359 >At1g15840.1 68414.m01901 expressed protein Length = 126 Score = 28.3 bits (60), Expect = 6.1 Identities = 17/48 (35%), Positives = 18/48 (37%) Frame = -2 Query: 646 GGXXXXVXGGGXXPPPXFXGGGGXXXPXNPXXXGGGXKXXXPXXGGGG 503 GG GGG GGGG N GGG + GGGG Sbjct: 14 GGGGDGTKGGGNT----ITGGGGEGKKKNGGGEGGGGEGTSGEGGGGG 57 >At1g11070.1 68414.m01268 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 554 Score = 28.3 bits (60), Expect = 6.1 Identities = 13/39 (33%), Positives = 14/39 (35%) Frame = +3 Query: 507 PPPXXGXXLXXPPPXXXGLXGXXXPPPPKXXGGGXXPPP 623 PPP L PPP + PP G PPP Sbjct: 224 PPPPGRAALPPPPPLPMAVRKGVAAPPLPPPGTAALPPP 262 >At4g15160.1 68417.m02327 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to SP|Q00451|PRF1_LYCES 36.4 kDa proline-rich protein Lycopersicon esculentum, proline-rich cell wall protein [Medicago sativa] GI:3818416; contains Pfam profile PF00234 Protease inhibitor/seed storage/LTP family Length = 428 Score = 27.9 bits (59), Expect = 8.0 Identities = 20/80 (25%), Positives = 23/80 (28%) Frame = +3 Query: 408 PPRGXLKXKXPXGFPGKPXXFFXXXGGXRXKXPPPPXXGXXLXXPPPXXXGLXGXXXPPP 587 PP +K P P + K PPPP P P PPP Sbjct: 90 PPPPYVKPPPPPTVKPPPPPYVKPPPPPTVKPPPPPTPYTP-PPPTPYTPPPPTVKPPPP 148 Query: 588 PKXXGGGXXPPPKTXXXXPP 647 P P P+ PP Sbjct: 149 PVVTPPPPTPTPEAPCPPPP 168 >At3g11130.1 68416.m01349 clathrin heavy chain, putative similar to Swiss-Prot:Q00610 clathrin heavy chain 1 (CLH-17) [Homo sapiens] Length = 1705 Score = 27.9 bits (59), Expect = 8.0 Identities = 15/42 (35%), Positives = 16/42 (38%), Gaps = 2/42 (4%) Frame = +2 Query: 527 PXFXPPPXXXGVGGXXXPPPPXKXG--GGXXXPPXNXXXXPP 646 P P P G+GG PPP G G PP PP Sbjct: 1660 PLALPAPPMPGMGGGGYGPPPQMGGMPGMSGMPPMPPYGMPP 1701 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +2 Query: 503 PXPPXXGGPXFXPPPXXXGVGGXXXPPPPXKXG 601 P P GG + PPP G+ G PP G Sbjct: 1666 PPMPGMGGGGYGPPPQMGGMPGMSGMPPMPPYG 1698 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,871,440 Number of Sequences: 28952 Number of extensions: 440110 Number of successful extensions: 4199 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2461 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1755792000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -