BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M10 (862 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock p... 76 1e-15 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 1.7 AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 25 3.9 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 24 5.2 DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. 23 9.0 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.0 >AF283275-1|AAG15376.1| 133|Anopheles gambiae small heat shock protein protein. Length = 133 Score = 76.2 bits (179), Expect = 1e-15 Identities = 41/88 (46%), Positives = 55/88 (62%), Gaps = 3/88 (3%) Frame = +1 Query: 457 KLRFDVSQYTPEEIVVKTVDNKLLVHAKHEEKSDTKS-VYREYNREFLLXKGTNPEXIKS 633 ++ DV Q++PEEI VK VDN +LV KHEEK D V R + R ++L KG N I S Sbjct: 16 QINLDVQQFSPEEISVKYVDNCVLVEGKHEEKQDDHGYVSRHFVRRYMLPKGHNEADIVS 75 Query: 634 SLSRDGVLTVEAPLPQL--AITDRNIPI 711 SLS DG+LT+ P ++ +R+IPI Sbjct: 76 SLSSDGILTITCPRKEIEQKNEERSIPI 103 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 1.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +3 Query: 237 HQRALRCRNEEDGRRNEQIQIRTHEQRKQQFLQEH 341 +++A R R E+D +NE ++ ++Q QEH Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEH 238 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 24.6 bits (51), Expect = 3.9 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = +1 Query: 226 EFSSIRERFDAEMRKMEEEMSKFRSELMNRESN 324 E R + +++ E+E++ FR+EL E+N Sbjct: 678 EMQKKRSEYSQLIQEHEKELADFRAELKQTEAN 710 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 24.2 bits (50), Expect = 5.2 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +3 Query: 663 GSAIATTRHHGQEHSYP 713 G+A AT HH Q H+ P Sbjct: 715 GAAAATGHHHHQHHAAP 731 >DQ974170-1|ABJ52810.1| 511|Anopheles gambiae serpin 12 protein. Length = 511 Score = 23.4 bits (48), Expect = 9.0 Identities = 12/35 (34%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 424 LIQDEGDGKTLKLRFDVSQY-TPEEIVVKTVDNKL 525 +I + +G+TLK +DV ++ T ++V K D L Sbjct: 1 MISEGAEGQTLKELYDVFKFPTDRDLVRKAFDVSL 35 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.4 bits (48), Expect = 9.0 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +3 Query: 231 LKHQRALRCRNEEDGRRNEQIQIRTHEQRKQQFLQEHN 344 L+HQ + + ++ ++ +Q Q H+Q +Q LQ H+ Sbjct: 1300 LQHQYQQQLQQQQQQQQQQQQQ---HQQHQQHQLQHHH 1334 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 759,576 Number of Sequences: 2352 Number of extensions: 14345 Number of successful extensions: 98 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 94 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 91786122 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -