BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M07 (843 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) 43 4e-04 SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.7 >SB_4350| Best HMM Match : L15 (HMM E-Value=3.9e-10) Length = 173 Score = 42.7 bits (96), Expect = 4e-04 Identities = 22/50 (44%), Positives = 25/50 (50%) Frame = +2 Query: 392 PLXXIVXXGYYKXLGXXNXPXHPVXXXXXXXSXSAEXXMXDVGGACVLSA 541 P+ +V GYYK LG P PV S AE + VGGACVL A Sbjct: 124 PVIDVVKAGYYKVLGKGLLPKQPVIVKAKFFSRRAEDKIKAVGGACVLMA 173 >SB_1528| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2409 Score = 29.9 bits (64), Expect = 2.7 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 550 KILVSCPARRRKILWLTPVLS--HWVCAVPFPPXGXXPPXDXGXXAP 684 K SC +RR+K+L P L+ +W +P PP PP G P Sbjct: 1719 KTTSSCGSRRKKVLKPPPRLAILNWADLLP-PPPSHPPPSSLGSPPP 1764 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,243,039 Number of Sequences: 59808 Number of extensions: 182047 Number of successful extensions: 386 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 382 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -