BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= MFBP03_F_M05 (860 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 27 0.29 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 24 1.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 23 2.7 U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 22 6.3 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 22 6.3 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 26.6 bits (56), Expect = 0.29 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 1/73 (1%) Frame = +2 Query: 191 LIPVHVSYLARP-VSLVIVQHTVTPFCRTDAGCEELVRNIQTNHMEALQYWDIGPSFLVG 367 ++ + V Y++ P +S+ TP R A E+ + N + Q P+FL Sbjct: 181 ILAIKVYYISCPEISVNFAHFPATPTGREVALIEQTIGTCVANAVVIEQ-----PTFLCK 235 Query: 368 GNGKVYEGSGWLH 406 G+GK Y SG H Sbjct: 236 GDGKWYLPSGGCH 248 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 24.2 bits (50), Expect = 1.6 Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 7/74 (9%) Frame = -3 Query: 729 PRSEHKQERRYXIRCDNVTRS*WSPRSP------ATQ-ASVRIWL*SFPXGLSEAMSCRC 571 PR +Q +R I + + R SPRSP A Q AS P G S+ + +C Sbjct: 714 PRMTAEQLKRTDIIHNYIMRGEASPRSPNASPSPAEQCASTTTITARSPQG-SQGL-LQC 771 Query: 570 ATTR*SPARWPRST 529 AT+ S RWP ++ Sbjct: 772 ATSNYSTTRWPATS 785 Score = 23.0 bits (47), Expect = 3.6 Identities = 25/72 (34%), Positives = 31/72 (43%), Gaps = 12/72 (16%) Frame = -2 Query: 577 SVRHDAVVPREVAALHAAAQQRPQ-RLQHRAA--------RLVRVEVA---DECDSDGPR 434 +VR V RE A + AA QQ R Q +A RL+ V D CD + Sbjct: 137 AVRFGRVPKREKARILAAMQQSSHSRSQEKAVAAELEDEQRLLATVVQAHLDTCDFTRDK 196 Query: 433 VVPVGVRADVQP 398 V P+ VRA P Sbjct: 197 VAPILVRARETP 208 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.4 bits (48), Expect = 2.7 Identities = 12/44 (27%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -3 Query: 198 GIK--PSHCFLLTTSQSAAISVRSELRASASTTAEWRRAMSRSG 73 G+K P HC + A I++++ + +S S WR +G Sbjct: 1165 GVKSAPIHCQTEQDAPEAPIAIKALVMSSESILVSWRPPSQPNG 1208 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 22.2 bits (45), Expect = 6.3 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -3 Query: 381 TLPLPPTRNEGPMSQY 334 T+P+P N+G ++QY Sbjct: 55 TIPVPQAANKGMINQY 70 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 22.2 bits (45), Expect = 6.3 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 151 CYFCEKRAESEREYNC 104 C C++R E + Y+C Sbjct: 274 CSLCQRRFEEQGNYSC 289 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,020 Number of Sequences: 438 Number of extensions: 4567 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -